KEGG   Purpureocillium lilacinum: VFPFJ_01422Help
Entry
VFPFJ_01422       CDS       T05029                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00250  Alanine, aspartate and glutamate metabolism
plj00410  beta-Alanine metabolism
plj00430  Taurine and hypotaurine metabolism
plj00650  Butanoate metabolism
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
Module
plj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VFPFJ_01422
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VFPFJ_01422
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VFPFJ_01422
   00430 Taurine and hypotaurine metabolism
    VFPFJ_01422
Enzymes [BR:plj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VFPFJ_01422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 28883555
NCBI-ProteinID: XP_018184031
UniProt: A0A179HZJ0
LinkDB All DBs
Position
Unknown
AA seq 523 aa AA seqDB search
MPASDHEHEAEALHGFSNGNGHPKGKSSLHRAEEMEDLFDAVKALIIPYIKAADDAASVK
ATGLPERDVSGRPRTTLVEPYSPQELSQRLGFSLPAEEGLGRTGLVDMVRDVLRYSVNTW
DQGFMDKLTASTNPVGVVSEILLGVLNTNVHVYHVSPALTIIEKSTAKALASYFGFVGPH
AGGVTCQGGSASNLTSLAIARSALYPETKLQGSGRHRFAIFTSAHGHFSVEKAAVTCGMG
AESVVSVPVDGLGRMMPSALRSLVIEAQARGMTPLYVNATAGTTVMGMYDPVRAIRAVCD
EFGMWLHVDGSWGGSVCFSRKHRHKLDGCELADSLTINPQKMLNVPMTCSFLLTNDLRRF
HAANSLRAGYLFHDPENDEVWDLADLTLQCGRRADSLKLALAWVYYGPLGFEKGVDHAFD
MAYRLTELVAASPDFELISTDPPSCLQVCFYYAPGGTVSESNEENTRRTRAMVDKMLLRG
FMFDFAPGPKGHFFRVVVNCQTLAGTVDGLFKALGEVGKEVVA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctctgatcacgagcatgaagccgaggcacttcacggcttttccaacggcaat
ggccacccaaagggcaagtcttctctgcatcgcgcagaggagatggaagatctcttcgat
gccgtaaaagccctcatcattccgtacatcaaggccgcagatgacgcggcctccgtcaaa
gcgaccggcctccctgagcgcgatgtaagcggtcggccacgcaccaccctcgtggaaccg
tattcgccgcaggagctgtcacaacgactcgggttctcgctaccggctgaggagggtctg
gggaggacgggactcgtcgatatggttcgggatgtgctgcggtacagcgtcaacacctgg
gaccagggcttcatggacaagttgaccgccagcacgaaccccgtcggggtcgtatcggag
attctcctgggggtgctcaacaccaacgtccacgtctatcacgtctcgcccgccctcacc
atcatagagaagagcacggccaaggcactggcatcatactttggctttgtcggaccacat
gcaggaggagtcacatgccagggaggcagcgcgtccaacttgacgtctcttgcaatcgct
cgcagcgcgctgtacccagagacgaagctgcagggttctgggagacatcggttcgccatc
tttaccagcgctcacgggcacttctcggtcgaaaaggcagccgtgacatgcggcatgggc
gccgagagtgtcgtgagcgtgccggtcgacgggctggggcgcatgatgccatcggccctg
cgctccctcgtcatcgaagcgcaggcacggggcatgactcctttgtacgtcaacgcgacg
gctggcaccacagtcatgggcatgtacgacccggtgcgcgccatcagggccgtatgcgac
gagtttggcatgtggctgcacgtcgacggctcctggggcggctccgtctgcttctcgcgc
aagcaccgacataagctcgacggctgcgagctggccgactcgctcaccatcaacccgcaa
aagatgctcaacgtgccgatgacgtgctcgttcctcctgaccaacgacctgcgccggttt
cacgccgcaaactccctgcgcgcgggctatctcttccacgacccggagaacgatgaggtc
tgggaccttgccgacctgacgctgcagtgcggaaggcgcgcggacagcctgaaactcgcc
ttggcgtgggtgtactacgggccgttgggttttgagaagggcgtcgaccacgcattcgac
atggcgtaccgactcacagaactcgttgccgcgtcgcccgacttcgagctcatatcaaca
gacccaccgtcgtgccttcaggtgtgcttctactacgctcctgggggcacggtatcagag
tcaaatgaagaaaacacaaggcgcacaagggcgatggtggacaagatgctcctgcggggc
ttcatgtttgactttgcgccagggcctaagggtcacttcttcagagtcgttgtcaactgc
cagacgcttgccggcaccgtggacggattgttcaaggctttgggggaggtcgggaaagaa
gtcgtcgcgtga

DBGET integrated database retrieval system