KEGG   Purpureocillium lilacinum: VFPFJ_01429Help
Entry
VFPFJ_01429       CDS       T05029                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
plj  Purpureocillium lilacinum
Brite
KEGG Orthology (KO) [BR:plj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:plj03036]
    VFPFJ_01429
Enzymes [BR:plj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     VFPFJ_01429
Chromosome and associated proteins [BR:plj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     VFPFJ_01429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 28883562
NCBI-ProteinID: XP_018184038
UniProt: A0A179I0U2
LinkDB All DBs
Position
Unknown
AA seq 1156 aa AA seqDB search
MSQPKQSAPPPRQSTGSASVAGMTANGDDDTGLTQSLSQLSLAGQPPPAKSPQIKTTPAA
LKPPSRRSSSTATSPRPRLPSRSPSNGRESRASRAGTPPLLRKASLNSLHSLNGSSTARP
ASRRSSSSHFTPGLNKTGHIGANVPEEEEREPVTANSVARDYFKAELAAHHGEARTRQTE
TIVILNDAVYGHRFSRPRTSRSALSTIVERPERIKAGVLGISTAYVHLGGRHSEGTLPID
PKRDVHGVPGIPFRIRKTTRRLPLASPAVTNVHGTKWMDELKLMCDSAEAKLAMGGRELQ
RPVMPRGPDEGPPQKLHEGDLYLCSESLTAIEGALGAVCEAVDTVFTTDYRRAFVGVRPP
GHHCSASHPSGFCWVNNVHVGIMHGVLTQGMTHAAIIDFDLHHGDGSQSITWQHNTRAVS
ATKNASPWKKTSIGYFSLHDINSYPCEMGDEEKVKNASLCIDNAHGQTIWNVHLQSWKTE
QDFWALYESKYMVLLDKTRNYLKNQAERLTALGQTPKAAIFFSAGFDASEWESAGMQRHQ
VNVPTEFYARLSQDVVRLAAEEGLHVDGRVISVLEGGYSDRAISSGVLSHLSGLVGDQAP
GKHFQDSPGLGSEMGLRIGVIEDGPQVATTRPLASTHLYDPLWWASGELDKLERLTEPPS
PPRKPRNTAQPTYSSPTQASTARVVDPVRMRRSLSGVSTRVIERPPSPPPPEVPWVIAAQ
ELCKLLIPSERQTDSCKPEDLNAEATKARRDRASNLMGLPPPPDPPSRPGSRMALRERKA
RAIGPIDEETNEQLPKTRRRNGATPPSTRSTPSRQNGGQTARRASRRLSGASSVVSPAYE
EPPPLPGSDGSASRPPSAVSSRTESSGKLAVKKTRPAAPRKEAAPRARSPRKASTPARKK
APASATQTPQRPSTAPGPVSSDGSGMDNITTGMKKIKINLITQAQKEARERARIDTEKAS
KAAGAPETPVAKVEEPSTTPSVETLPQLPALTQAGDSPTKPAALGSSLAPEPPSSSTGPQ
TPIDEPYTSVLATPEPRQVPLPASSPALNDSTSQPATDTSDFFISYQPEGPAPVAVSQQE
PLTWLPPTLGTPAAGTPAATPSPQKKQNGLFHYKSGIPFAPRPATGTPKPEVGTYSGKSE
ASKHSSVWDYPETPKK
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaccgaaacaatcggcgccgccgccgcgacaatcgaccggctccgcgtccgtg
gccggcatgactgccaacggcgacgatgacaccggcctcacgcagtcgctgagccagctc
tctctggctggtcagccgccgcccgccaagtctccccagatcaagacgacgcctgcggcc
ctcaaaccgccgtcgcgacgttcgtccagcaccgcgacctctcctcgaccccgacttccg
tcccgcagcccctcgaatggacgcgagtcccgagcctcacgcgcaggcacgccgcctctc
ctcaggaaggcgtcgctgaattcgcttcattccctcaacggctccagcaccgcacgacct
gcgtcacgccggtccagctcctcgcacttcacccctgggctgaataagacggggcacata
ggcgcaaacgtgccggaagaagaggagagggagcccgtaacggcaaattcggtcgccaga
gactacttcaaggctgagctcgctgctcatcacggcgaagcgcgaacgcgacagaccgag
accattgtcattctcaacgacgccgtgtatggccacagattctcgcgaccccgaacctct
cgcagcgccctgagcaccattgtcgagcgacccgagagaatcaaggctggagtgttgggt
atctcgacagcctacgtgcacctgggtggacgacatagcgagggaacactccccattgac
cctaagagagacgtgcatggtgtacctggcatcccctttcgcatccgaaagactacaagg
cgcttaccgctggcgtcgccggcagtcactaatgtccatggaaccaagtggatggacgag
ctcaagctcatgtgcgactcggccgaggccaagttggccatgggtggaagggagctgcag
cgacctgtcatgccgcggggcccagacgagggcccgccccaaaagcttcacgaaggcgac
ctctatttatgctccgagtccctgactgctatcgaaggagcgttgggggcggtctgtgag
gctgtcgatacggtcttcacgacggactaccggagggcctttgtgggcgtgaggccgccg
ggacaccactgctccgcgtcgcacccctcgggattctgctgggtcaacaatgtacacgtt
ggaattatgcacggagtgctcacgcaaggcatgacgcacgcagctatcatcgactttgac
ctacaccacggcgacggctcccagtccatcacttggcagcacaacacgcgtgcggtatcg
gcgaccaagaatgcgtctccgtggaaaaagacctcgataggctactttagcctccacgac
atcaactcgtatccttgcgagatgggtgacgaggaaaaggtcaaaaacgccagtctttgc
atcgacaatgcacacggccagacaatctggaacgtccacctgcagtcatggaagacggag
caggatttctgggcattgtacgagtctaaatacatggtgttgctggacaagacgcgcaac
tatctcaagaaccaagccgagcgactcactgcgctgggacagaccccgaaggcggccatt
ttcttctccgccggctttgatgccagcgagtgggaaagcgccggcatgcagcgccatcag
gtcaacgtgccaactgagttctatgccaggttatcgcaggacgtggtcaggctggcagcc
gaggaaggcttacacgtggatggcagagtcatcagcgtgctcgagggcggctacagcgac
agagcaatttcatctggcgtcctcagccatttgagcggactcgtaggcgaccaagcgccc
gggaagcacttccaagactcgcccggactcggcagcgagatgggtctgcgaattggcgtc
atcgaagatggaccgcaagtcgcgacgacccgacctctcgcgtcgacacacttgtacgat
ccgctctggtgggccagcggcgagctggacaagttggagcgtctcaccgaacccccctcg
cctcctcgcaagccacgcaacacagcgcaaccgacgtactcgtcgcccacccaggcgtcg
acagccagagttgtcgacccagttcggatgcggcgcagtctatccggggtttccacgagg
gtcatcgagcgcccaccgtcgcccccgcccccagaagtcccctgggttattgcagctcag
gagctctgcaagttgctcataccttcagagcgtcagacggatagctgcaagccggaggac
ttgaatgcggaggcgacaaaggctcggcgggaccgcgcgtcgaatctgatgggcctaccg
ccgcctcctgaccccccgagccggcctggatcgcgaatggctctgcgtgagcgaaaggcc
agggccatcggcccaatcgacgaagaaacaaacgagcaacttcccaagactcgtcgcaga
aatggtgcaacaccgccttccactcgcagtacaccatcacgtcagaatggcggccaaaca
gccaggagggccagccggcgccttagtggagcgtcgtccgtggtcagtccggcgtatgag
gaaccaccgccactgcctggcagcgacggcagtgcaagtcgacctccgtctgctgtgagc
tctcgaaccgagagcagtggaaagcttgccgtgaagaagacccggccggcagctccgcga
aaagaagcggcacctagggctcggagcccaaggaaggcttcgacgccggctcgcaagaaa
gcaccagcctctgcgactcagacgcctcagcgaccgtcgaccgcacctggtccggtctcc
agcgacgggtcggggatggacaacatcacgacgggcatgaaaaagatcaagatcaacttg
atcactcaagcgcaaaaggaggccagagagcgcgctcgaatcgacacagagaaagcctcg
aaggctgctggggcaccggaaacacctgtcgcaaaggtagaagaaccatcgacaactccc
agcgttgagaccttgcctcagttgccggccttgacgcaggctggtgactcccccacgaag
cccgcggctcttgggtcgtcactggcaccagagccaccgtcctcctcaaccggaccgcaa
actccaatcgacgagccttacacatccgttctggcgacgccagagccgcgtcaagtgcca
cttccagctagcagcccggccttgaacgactccacgtcgcagccggcaacggacaccagc
gactttttcatctcgtaccagcccgaggggccggctcccgtcgccgtctcgcagcaagag
cccctgacatggctgccaccgacgttgggcacgcccgcggccggcacacccgcggcgacg
ccgagtccgcagaaaaagcaaaacggcctgttccattacaagtctggtatcccttttgcg
ccgcggccagcgacaggcacgccgaagcccgaggtgggcacgtacagcggcaagagcgaa
gcctccaagcattcgtcggtgtgggactatccagagacgcccaagaaatag

DBGET integrated database retrieval system