KEGG   Purpureocillium lilacinum: VFPFJ_03036Help
Entry
VFPFJ_03036       CDS       T05029                                 

Definition
(RefSeq) alpha-amylase A type-3 precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00500  Starch and sucrose metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VFPFJ_03036
Enzymes [BR:plj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VFPFJ_03036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1966 Cellulase hDGE_amylase GHL6
Motif
Other DBs
NCBI-GeneID: 28885167
NCBI-ProteinID: XP_018182592
UniProt: A0A179GM52
LinkDB All DBs
Position
Unknown
AA seq 457 aa AA seqDB search
MKLSGLIALVQLCAAALAADTAAWKARNIYFALTDRIARSSSDGGGGSCGDLGNYCGGTF
QGLQSKLDYIKGLGFDAIWITPIVANSDGGYHGYWAQDLYTVNSKYGSADDLKSLVNAAH
DKGIYIMVDVVANHMGNANLADNKPTPLDQASSYHPACDIDYSNQSSIENCRIGGLPDVD
TQDPTIRKLYQSWVSWLISEFGFDGVRIDTVKHVEKDFWPDFASAAGVYTIGEVFDGNPD
YLAGYAGLMSGLLNYAIYYPLNNFYQQKGSSQALVDMHDTVSQKFPDPAALGTFLDNHDN
PRWLNQKNDQVLLRNALTYVLLARGVPILYYGTEQGYAGGADPANREDLWRSGFATDGAM
YKFIAAVAGVRKSAGGLPDNDHVHLYVADTAYAWSRAGGKVIALTSNGGKSQQYCFNSQK
QNGSWKGALDGKTYTSDGSGQLCADVVNGEPIVLVSQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctctgggctcattgcgctcgtacagctgtgtgccgcagccctggctgcggat
accgccgcttggaaggcgcgcaacatctacttcgcgcttaccgatcgtatcgctcgaagc
agcagcgatggcggaggtggctcgtgcggcgacctgggcaactactgtggcggcacattt
caaggtctgcagtccaagctcgactacatcaagggtctcggcttcgacgccatctggatc
acaccgattgttgcaaatagcgatggaggctaccatggatactgggcccaggacttgtac
acggtcaactccaagtacgggtccgcagatgacctgaagagccttgtaaatgcggctcac
gacaagggcatttacatcatggtcgacgtcgtcgccaaccacatgggcaatgccaacctt
gccgacaacaagcccactccgctagatcaggcatcgtcctaccatccagcctgcgacatc
gactactctaatcagagcagcattgagaactgccgcattgggggcctcccagatgtcgat
acgcaggaccctaccatcaggaagctctaccagtcctgggtcagttggctcatctccgag
tttggcttcgacggagtgcgcatagacactgtcaagcacgttgagaaggacttttggccc
gactttgcctcggcagctggcgtctacacaattggcgaggtctttgacgggaaccctgac
taccttgccggctacgcgggcctcatgtcgggtctgctcaattacgccatctattatccg
ctcaataacttttaccagcaaaagggctcatcgcaggccctcgtcgatatgcacgacacc
gtgagccaaaagttcccggaccctgctgcgctgggcacgttcctggacaaccacgacaac
ccacggtggctgaaccagaagaatgaccaggtcctgctacgcaacgcgctgacatacgtc
ctcctcgctcgcggagtaccgattctctactacggtactgagcaaggctacgccggcggc
gcggatccggcaaaccgagaggacctctggcgcagcggattcgctaccgatggagccatg
tacaaatttatagccgcggtagcgggagtgcgcaagagcgccggcggactacctgacaac
gatcacgtccacctctacgtcgcagacaccgcgtatgcgtggagtcgcgccggcggcaag
gtcattgcgctgacgagcaacggcgggaagtcgcagcagtactgcttcaattctcagaaa
cagaacgggtcgtggaagggagcgctggatggcaagacgtatacgtcggacggaagcgga
cagctgtgcgccgatgtggtcaatggagaaccaattgttctggtttctcaatga

DBGET integrated database retrieval system