KEGG   Purpureocillium lilacinum: VFPFJ_03193Help
Entry
VFPFJ_03193       CDS       T05029                                 

Definition
(RefSeq) SET domain-containingprotein
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    VFPFJ_03193
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:plj03036]
    VFPFJ_03193
Enzymes [BR:plj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     VFPFJ_03193
Chromosome and associated proteins [BR:plj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     VFPFJ_03193
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    VFPFJ_03193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET ThiC_Rad_SAM
Motif
Other DBs
NCBI-GeneID: 28885324
NCBI-ProteinID: XP_018180172
UniProt: A0A179GW83
LinkDB All DBs
Position
Unknown
AA seq 332 aa AA seqDB search
MEEVARRHFFHHGQDKYAHERDDCHWCQLRHFPTDRKAPVTVMNDVDDQALPRGFRFINS
GVLGDGVRPADESFRSGCACVDSTSCQFAGCQCLAELDEDNDSDDCSDGDEGGGHVPRKA
YAYHMHGAKAGLLRSKLHNSKVPLYECHQGCSCAPDCPNRVVERGRTVPLQIFRTDDRGW
GVRTQEALKKGQFVDRYFGEIITSAEADRRRDAAAVSQRKDVYLFALDKFTDPDSLDPRL
RGPPLEVDGEFMSGPTRFINHSCDPNLRIFARVGDHADKHLHDLALFAIRDIQRGEELTF
DYVDGVSQDPDDEQDGMTRCLCGSSKCRGYLW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtggccaggagacacttctttcaccatggccaagacaaatacgctcacgag
cgtgacgactgccactggtgccagctgcgtcactttccaactgaccgcaaggcccccgtc
acggttatgaatgatgtcgacgaccaggccctcccgcgcggcttccgcttcatcaacagc
ggtgtccttggtgacggcgtcaggcccgctgatgagagttttcgcagcggctgcgcctgc
gtggattcgaccagctgtcagtttgcgggctgccaatgccttgctgagctcgacgaggat
aacgatagcgacgactgcagcgatggcgacgagggaggcggccatgttccgaggaaagcg
tacgcctaccacatgcacggcgccaaggctggcctcctcaggtccaaactacacaactca
aaggttccgctgtacgagtgccaccaaggctgctcttgtgcgcctgactgtcccaaccgg
gtagtcgagcgtggccgcaccgtcccgctgcagattttccggaccgatgaccgtggatgg
ggtgtacggacacaggaggcccttaagaagggacagtttgtggaccgctacttcggtgag
atcatcacgtctgccgaggctgaccgccggcgcgacgcggccgccgtatctcagcgcaag
gatgtgtaccttttcgcgctcgacaagtttaccgatcccgactcactcgatccgcggctc
cgagggccgcctctggaggtagatggcgaattcatgtcgggtccgacacgcttcatcaac
cattcgtgcgaccccaacctgcggatttttgcccgcgtcggcgaccatgccgacaagcac
ctgcatgacctcgcgctctttgccatccgggacattcagcggggcgaagagttgacgttt
gactacgtcgatggggtgtcccaggaccctgacgatgaacaggatggaatgacgcgatgc
ctgtgtgggagctccaaatgcaggggctatctatggtga

DBGET integrated database retrieval system