KEGG   Purpureocillium lilacinum: VFPFJ_05321Help
Entry
VFPFJ_05321       CDS       T05029                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00020  Citrate cycle (TCA cycle)
plj00190  Oxidative phosphorylation
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
plj01130  Biosynthesis of antibiotics
plj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VFPFJ_05321
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VFPFJ_05321
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VFPFJ_05321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DUF600
Motif
Other DBs
NCBI-GeneID: 28887450
NCBI-ProteinID: XP_018179881
UniProt: A0A179HMR5
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MASSMALRKLASGSAFSRLARNQARAFSTTRPVARVISNGPLRAKEASPFVSNKYPVIDH
EYDALVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEEGKIYQRAFGGQSQKY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMQDGECRGVLAYNQE
DGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGAE
KDHIFLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGE
VITVDEKGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPGT
KLKPLAADAGAEHIEVLDKVRTSEGPKSTAEIRLAMQKAMQTDVSVFRTQESLDEGVRKM
VDIDAQFHDVGIKDRSMIWNSDLVETLELRNLLTCAVQTATAAAARKESRGAHAREDFPD
RDDENWMKHTLSFQKKPHEKVDLSYRKVIATTLDENECKPVPPFKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccatggctctgaggaaattggcctctggctctgctttttcgcggctggcg
agaaaccaggccagggccttttcgacgacacgacccgtcgcacgagttatctcgaacggc
ccgctgagggcaaaggaggcctcgcctttcgtgagcaacaagtaccccgtcattgaccac
gagtacgatgcactcgtcgtcggtgccggtggctccggtctgcgggccgcctttggtctt
gccgaggcaggcttcaacaccgcctgtatctccaagctcttccctacccgaagccacaca
gtcgccgcgcagggtggcatcaacgctgcccttggcaacatgcacgaggatgactggaga
tggcacatgtacgacactgtcaagggctccgactggcttggcgaccaggacgccattcac
tacatgacccgcgaggcccctgcgtccattatcgagcttgagcactacggctgccctttc
tcgcgaaccgaggaaggcaagatctaccagcgtgctttcggtggtcagtcccaaaagtac
ggcaagggtggtcaggcctaccgatgctgcgctgccgccgatcgaaccggccacgctctc
cttcacacgctctacggccagtcgctccgacacaacaccaactacttcatcgaatacttt
gccctggacctgatcatgcaagacggtgagtgccgaggtgtcctcgcctacaaccaggag
gacggcactctccaccgattcctcgccaaccacaccgtcttggccactggcggctatggc
cgtgcctacttcagctgcacgtccgcccacacctgcactggtgacggtatggccatggtt
gcccgtgctggtctccccaaccaggatcttgagttcgtccagttccaccccactggtatc
tacggagccggctgcctgatcactgagggtgcacgtggtgagggtggctatctgctgaac
tcggagggtgagcgcttcatggagcgttatgccccgactgccaaggatctggcctcccga
gatgtcgtttcccgttccatgaccatggagatccgcgatggacgtggtgtcggtgctgag
aaggaccacatcttcctgcagctgagccacctgcctgctgagatcctcgctgagcgcctg
cccggtatctcagagaccgctggcattttcgccggtgtcgatgtccgaaagcagcccatc
cccgttctccctaccgtccactacaacatgggtggcattcccactcgctacactggcgag
gttatcactgtcgatgagaagggcaatgacaaggttgtgcctggcctgttcgcctgcggt
gaagccgcttgtgtctctgttcacggtgctaaccgcctgggcgccaactctctcctggac
ctggtcgtcttcggccgcgccgtctcccacaccatccgcgacaacttcactcctggcacc
aagctgaagcccctcgctgctgacgccggcgctgagcacattgaggttctggacaaggtc
cgcacttcggagggtcccaagagcacggctgagatccgcctggccatgcagaaggccatg
cagacggatgtcagcgtcttccgtacccaggagagcttggacgagggtgtccgcaagatg
gtcgacatcgatgcccagttccacgatgtcggtatcaaggaccgcagcatgatctggaac
tcggacctggttgagacgctcgagctccgcaacctgttgacttgcgccgttcaaaccgcc
actgccgccgccgcccgcaaggagtctcgtggtgcgcacgcccgcgaggacttccctgac
cgtgacgacgagaactggatgaagcacacgctcagcttccagaagaagccgcacgagaag
gtggacctgtcttaccgcaaggtcatcgccaccactctggacgagaacgagtgcaagccg
gtgccccccttcaagcgtgtatactaa

DBGET integrated database retrieval system