KEGG   Purpureocillium lilacinum: VFPFJ_06270Help
Entry
VFPFJ_06270       CDS       T05029                                 

Definition
(RefSeq) glutathione S-transferase/chloride channel
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VFPFJ_06270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plj02000]
    VFPFJ_06270
Enzymes [BR:plj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VFPFJ_06270
Transporters [BR:plj02000]
 Other Transporters
  Pores ion channels [TC:1]
   VFPFJ_06270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_5 GST_C_6 DUF421 GST_N_4
Motif
Other DBs
NCBI-GeneID: 28888394
NCBI-ProteinID: XP_018178575
UniProt: A0A179HHF6
LinkDB All DBs
Position
Unknown
AA seq 213 aa AA seqDB search
MSGLKPIKVWIHGQGPNPRKVLITLEELAIPYESITIENPKEASFLKINPNGRLPAIQDP
NNDDLILWESGAIVEYIVESYDKEHKLTFTTNPEKWLLKQYLHFQMSGQGPYFGQAVWFR
KFHPEDVASAKKRYDEQTVRVFEVLNTILEGKQYLVGEKFTYADLCFIPWDFVVQGFLTD
VWADHEVDKKYPNFVAWHKRITERESVKKVYSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactgaagcccatcaaggtttggatccacggccagggccccaacccgcgcaag
gtcctcatcaccctcgaggagctcgccatcccctacgagtccatcaccatcgagaacccc
aaggaggcgtcctttctcaagatcaaccccaacgggcgcctgccggccatccaggacccc
aacaacgacgacctcatcctgtgggagtcgggcgccatcgtcgagtacattgtcgagagc
tacgacaaggagcacaagctcacgttcacgactaacccggagaagtggctgctgaagcag
tacctgcacttccagatgtccggccagggcccttactttggccaggcggtctggttccgc
aagttccaccccgaggatgtggcgagcgcgaagaagcgctacgatgagcagacggtaagg
gtgtttgaggtgctgaacacgatccttgagggcaagcagtacctcgttggcgagaagttc
acgtacgccgacctgtgcttcatcccctgggactttgtcgtccagggcttcctcaccgat
gtgtgggccgaccacgaggtcgacaagaagtaccccaactttgtcgcgtggcacaagcgc
atcacggagcgcgagtcggtcaagaaggtgtacagcgcttag

DBGET integrated database retrieval system