KEGG   Purpureocillium lilacinum: VFPFJ_06453Help
Entry
VFPFJ_06453       CDS       T05029                                 

Definition
(RefSeq) D-xylulose reductase A
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00040  Pentose and glucuronate interconversions
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VFPFJ_06453
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     VFPFJ_06453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N MFS_1 Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 28888577
NCBI-ProteinID: XP_018178759
UniProt: A0A179HKN9
LinkDB All DBs
Position
Unknown
AA seq 716 aa AA seqDB search
MGPFTREPAVPQEVMEKIEKHSMEKTSQVQDNAVGVGEDIVISSSPTMAGVFSKKALIFG
WASLLAVALMNYLDLVAVNTFQVYAMSEFNRLSIEGALTTAIGVATIVIQAPLAVTISHV
SYFSVFAVATVVTTLGSVLQAAAPGLGVFLLGFVLNMMGGMGTRMIMFNTATSLSTPKYR
GTALGAVNVPSVASSLAGAQVAESALKNIGWRWGYGIWAVMYAGINAAAAYFYPFLMVCS
DLSISNATYITLIVGVVCQLMGLVYGFIMARYKQMKWIYVSGLAIALLGRGLQYEFVDPR
TQMAGLVVSQLVAGIGFGVGIQGLTIAQGSANPKDYPIIIAIFFISSNVGASVAGAINPS
FVLRAVKDVTFEDRPVPDLKDPNDVLVHVGQTGICGSDVHYWQRGRIGSYILNGPMVLGH
ESSGTVVQVGRDVSSLRPGDKVAMEPGVPCRRCDHCRSGTYHLCGQMVFAATPPYDGTLA
KYYINAADFCYKVPDSMNLEEAAMVEPLSVAVAVAKTADLRAHQTVVVLGCGPIGVLCQA
VAKSWGAKKVIGVDVVDSRLEVAKSYGVDGVFKPQRAANATVDPMQHAEDVAEELKASFG
LGEGADVVLECSGAEPCVQMGIYVAKHGGTFVQAGMGKEVVSFPITTVCIRGLTIKGSIR
YLAGCYPAAIDLISSGKIDVKKLVTNRFKFEDAEKAFELVKEGRSDVFKVLIEGVQ
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgggtccctttacgcgggaaccagccgtcccccaagaggtcatggagaagatcgagaag
cacagcatggagaagacaagccaggtccaagataacgccgtgggcgtgggcgaggacatt
gtcatctccagttcaccaaccatggctggtgtattctctaagaaggccctcatcttcggc
tgggccagcttactcgccgtggctttgatgaactacctcgaccttgtcgccgtcaacacg
ttccaggtctatgcaatgagcgaattcaaccgcctgtcaattgaaggggctctcacgacc
gccatcggcgtcgcgaccattgttatccaagcgccattggcagtgaccatcagtcacgtg
tcttatttcagcgtatttgcagtcgccactgttgtgaccacgcttggcagtgtgcttcag
gccgctgctccggggcttggagtattcctcctaggtttcgtgttgaacatgatgggcggg
atgggcacccgcatgatcatgttcaacactgcgacaagcttaagtacccccaaataccgc
ggaaccgcgcttggcgcagtcaacgtgcccagcgttgcctcgtctttggctggcgcccag
gtcgctgaaagcgctctcaaaaacatcggatggcgatggggctacggtatctgggctgtc
atgtacgcaggtatcaatgcggctgcagcatacttctatccattcctcatggtttgcagc
gatctgagcatctctaacgcgacatacatcaccctcatcgtaggcgtcgtgtgtcagctc
atgggtcttgtgtatggatttataatggctcgttacaagcagatgaaatggatctacgtc
agtggtcttgccatcgccttgttgggacgtgggctgcagtacgaattcgttgatcctagg
acacaaatggcgggtttggtggtgagccagcttgtggctggcattggcttcggtgtcggc
attcaaggcctgacaattgcccaaggctctgctaatccgaaggactatcctatcattatc
gccatattcttcatatcctcgaatgtcggtgcttctgttgccggagccattaatccatct
tttgttttgcgagccgtcaaagatgtcacctttgaagaccggccagtaccagacctcaag
gacccaaatgatgtattggtgcacgtcgggcaaacagggatttgtggcagcgatgtccac
tactggcagcgtggccgtataggctcatacatcctcaatggccccatggttctcggtcac
gagtcctcaggcacggttgttcaagtcggccgcgacgtcagctcgcttcggccaggcgac
aaagtggcgatggagccaggcgttccctgccgacgttgcgatcactgtcgcagcggaacg
tatcacctctgtggacagatggtcttcgccgcaaccccgccgtatgacggcacgcttgca
aaatactacatcaatgccgccgacttttgctacaaggtccccgactcgatgaacctcgag
gaagcggcaatggtcgaaccgctctcagtggcagtggcggtggccaagacggcagacttg
cgggcccatcagaccgtcgtcgtgctaggctgcggtcccattggcgttctgtgccaggcc
gtggccaagtcttggggtgccaaaaaagtcatcggcgtcgacgttgttgattcgagactg
gaggttgccaagtcttatggcgtcgatggcgtctttaagccccaacgagcagcaaacgct
acggtcgacccgatgcagcatgcggaggacgtggccgaggaactcaaggccagctttggc
ctcggtgagggtgcagacgtcgtcctcgagtgctccggcgccgagccgtgcgtgcagatg
ggcatttacgtggccaagcacggcggcacctttgtccaagccggcatggggaaagaagtc
gtctcgttccccatcaccaccgtgtgcattcgcggcctgaccatcaagggctctattcgg
tatctcgcgggctgctatcctgccgccattgacctcatctctagcgggaagatcgatgta
aagaagctcgtgaccaataggttcaagtttgaggatgccgagaaggcgtttgagttggtg
aaggaagggcgaagcgatgtgttcaaggtcctgattgaaggtgttcagtga

DBGET integrated database retrieval system