KEGG   Purpureocillium lilacinum: VFPFJ_06978Help
Entry
VFPFJ_06978       CDS       T05029                                 

Definition
(RefSeq) glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00500  Starch and sucrose metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VFPFJ_06978
Enzymes [BR:plj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     VFPFJ_06978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 DUF3318
Motif
Other DBs
NCBI-GeneID: 28889102
NCBI-ProteinID: XP_018177232
UniProt: A0A179HGA8
LinkDB All DBs
Position
Unknown
AA seq 668 aa AA seqDB search
MEVLDQDIPGLSVNDTASLVNPIMHFLSTALLLGSVAVQHVLGRAGASRQPLLLKRSVDS
FIGTETPIALEQLLCNIGSDGCNAQGAASGAVIASPSKQDPDYFYTWTRDSALVFKATVD
RFTTQYDAGLQRHIQEYIASQAKLQGISDPSGSLSDGQGLGEPKYNADLTAFTGAWGRPQ
RDGPALRAIAMITYANWLVQNGYTSTASTIVWPVVQNDLNYVAQYWNRTGFDLWEEVNGS
SFFTVASQYRALIDGGNLASTLGKPATSYTAVAPQILCFLQTFWDSSGGYARANINVNNG
RAGKDANTILASIHSFDPKLGCDAATFQPCSDRALSNHKATVDSFRTYKINSGLGKGKAA
AVGRYIEDVYYNGNPWYLATLAAAEQLYDALYVWKQAGSVAVTDTSLAFFQDLVPGAAKG
TYASGSATFTSIVDAVSAYADGFVNIVATYAAANGSLAEQFSKDDGHPMSARDLTWSYAA
FLTAAARRAGVVPPSWANDKATSVPGTCSATSVVGSYSSATATSFPPSQTPSTGVPPTSV
TTSTTGSPSSSTTTSTTTSSCQAATSVAVTFKELVTTKYGQTIKIVGNTGALGNWDTSKA
VALEASEYTSSNPLWKGTVTLPAGQVIEYKYINVNTDGSVTWEKDPNHTYTVPKSCATSA
TQSDKWQG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctcgaccaggacatccccggcctgtccgtcaacgacacggcgtctctcgtg
aaccccatcatgcacttcctctccaccgctctgctcctgggctctgtggccgttcagcac
gtcctcggacgcgccggcgcgagcaggcagccccttctcctgaagcgctccgttgactcc
ttcatcggcacggagacccctattgccttggagcagttactctgcaacattgggtctgat
ggctgcaatgctcagggcgctgcgtctggtgctgtcattgcctcgcccagcaagcaggac
cccgactacttttatacatggacccgggatagcgccctggtatttaaagctactgttgac
cggttcactacccagtatgacgccgggctgcagcgccatatccaagagtacattgcctcg
caggcgaagctccagggcatatcggacccttccggatccctgtctgacggccagggcctc
ggggagccaaagtacaatgcggacctgactgcctttaccggtgcatggggtcgacctcag
cgggacggtcctgccctgagagccatcgccatgatcacgtacgccaactggctcgtgcag
aacgggtacacctcaacggcttctactatcgtctggccggtcgtccagaatgatctgaac
tacgtggcacagtactggaaccggactgggttcgacttgtgggaggaagtcaacggcagt
tcctttttcaccgtcgctagccagtacagagctctcatcgatggcggcaatctggcatcc
accctcggaaaacccgccacctcatacaccgcagtcgcgccgcagatcctgtgcttcctc
cagaccttctgggactcgtccggaggctacgcccgggcaaacatcaacgtcaacaacggc
cgcgcaggcaaggatgccaataccatcctagcgtccatccactccttcgaccccaagctg
ggctgcgacgccgccaccttccagccctgcagcgacagggccctctccaaccacaaggcc
accgtcgactccttccgcacgtacaagatcaacagcgggctcggcaagggcaaggccgcc
gccgtgggccgctacatcgaggacgtctactacaacggcaacccgtggtacctcgccacc
ctggccgccgccgagcagctctacgacgcgctgtacgtgtggaagcaggccggctccgtc
gccgtgacggacacgtcgctcgccttcttccaggacctggtccccggcgcggccaagggc
acgtacgccagcggctcggcgaccttcaccagcatcgtcgacgcggtgtcggcctacgcc
gacgggttcgtcaacatcgtcgccacgtatgccgctgcgaatgggtctctcgccgagcag
ttctccaaggacgacgggcatcctatgtctgcgcgggacctgacgtggtcgtacgcggcc
ttcctcacggcggctgcgcgccgagctggcgtcgtgccgccgtcgtgggcaaacgacaag
gccacgtccgttccagggacgtgctccgccacgtctgtcgtggggtcctactcgagtgcc
acggccacgtcgttcccgccgtcccaaacaccctcgacgggcgtgccgcccaccagcgtg
accacctccaccacaggcagcccttcctcctccacaacgacgtcaacaaccacctcttca
tgccaggcagccacgtccgtcgccgtgacgttcaaggagctagtcacgacaaagtacggc
cagacgatcaagattgtcggcaacaccggcgccctggggaactgggacacgagcaaggcc
gttgcccttgaggcgtccgagtacacgtcgagcaaccctctgtggaagggcaccgtgacg
ctcccggccggccaggtcatcgagtacaagtacatcaacgtaaacaccgacggctccgtg
acatgggaaaaggatccaaaccacacctacacggtgccaaagtcctgcgccacgagcgct
acccagtctgacaagtggcagggctga

DBGET integrated database retrieval system