KEGG   Purpureocillium lilacinum: VFPFJ_07953Help
Entry
VFPFJ_07953       CDS       T05029                                 

Definition
(RefSeq) fatty acid elongase (Gns1)
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00062  Fatty acid elongation
plj01040  Biosynthesis of unsaturated fatty acids
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
plj01212  Fatty acid metabolism
Module
plj_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    VFPFJ_07953
   01040 Biosynthesis of unsaturated fatty acids
    VFPFJ_07953
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:plj01004]
    VFPFJ_07953
Enzymes [BR:plj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     VFPFJ_07953
Lipid biosynthesis proteins [BR:plj01004]
 Elongase
  LCFA
   VFPFJ_07953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 28890076
NCBI-ProteinID: XP_018176421
UniProt: A0A179H5X4
LinkDB All DBs
Position
Unknown
AA seq 345 aa AA seqDB search
MSSAPASFYEQLPLPTLDRPFGIHLWPIFDKAWTAVLGYPTDEFKFVPFETPLSTLKSSA
IFIVVYYIVILGGRELMRNREPFKLKTLFLIHNFYLTAISGILLALFIEQLLPTVVRHGI
FYAICDHNGGWTQPLVVLYYLNYLTKYLELLDTVFLFLKKKPLTFLHCYHHGATALLCYT
QLIGSTAVSWVVITLNLTVHVVMYWYYFQSARGVKIWWKEWVTRLQIIQFIIDLGFVYFA
SYTYFTSTYFQWMPNAGTCAGEEFAAFSGIAILSSYLVLFISFYFATYKKGGKGTTTRKS
LRRMSQAPLPDPLHIQAAANGTANGNGASTTGAKTNGATTRSRKA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgctccggcttccttttacgagcagctgccgctgccgacgctcgaccgtccc
ttcggcatccacctgtggcccatcttcgacaaggcatggaccgccgtcctcggctacccg
accgatgagttcaagtttgtgccgtttgagacgcccctgtcgaccctcaagtcgagcgcc
atcttcatcgtcgtctactacatcgtcatcctcggcggccgcgagctgatgcgcaaccgc
gagcccttcaagctcaagacgctgttcctcatccacaacttctacctcaccgccatcagc
ggcatcctcctggctctcttcattgagcagctcctgcccaccgtcgttcgccatggcatc
ttttacgcgatctgcgaccacaatggcggttggacccagcccctggttgttctctactac
ctcaactacctgaccaagtacctcgagcttctcgacactgtcttcctgttcctcaagaag
aagcccctgacgttcctccactgctaccaccatggtgccaccgccctgctttgctacacc
cagctcattggctcgactgccgtctcttgggtcgtcatcacgctcaacctgaccgtgcac
gtggtcatgtactggtactacttccagagcgcgcgcggcgtcaagatctggtggaaggag
tgggtcactcgtctccagatcatccagttcatcattgatcttggcttcgtctactttgcc
tcgtacacgtacttcacctcgacctacttccagtggatgcccaacgccggcacgtgcgcg
ggtgaggagttcgccgcgttttctggcattgccatcctcagctcttacctggtgctcttc
atctcgttctactttgcgacgtacaagaagggcggcaagggaacgaccacccgtaagtcg
ctgcgccgcatgagccaggctcccctccccgaccccctccacatccaggcggccgccaac
ggcactgccaacggcaacggcgcgagcaccaccggagccaagaccaacggcgccacgacc
cgctctcgcaaggcctaa

DBGET integrated database retrieval system