KEGG   Purpureocillium lilacinum: VFPFJ_08803Help
Entry
VFPFJ_08803       CDS       T05029                                 

Definition
(RefSeq) glutathione-S-transferase theta, GST
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VFPFJ_08803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plj02000]
    VFPFJ_08803
Enzymes [BR:plj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VFPFJ_08803
Transporters [BR:plj02000]
 Other Transporters
  Pores ion channels [TC:1]
   VFPFJ_08803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 28890925
NCBI-ProteinID: XP_018175628
UniProt: A0A179H0E9
LinkDB All DBs
Position
Unknown
AA seq 276 aa AA seqDB search
MPNVDTSLPPETTGAAAELAARHAANHPLKLYGGWFCPFVQRSWIVLVEKRIPHQYVEIN
PYNKEASFLAMNPRGLVPTLAVPVDASGQKQKPLFESSIISEYLDEAYADEGKHGPSLLP
KEPYEKARARLWIDHISTRIIPAFYKLLQHTPEKPYSIELARDELHGHIRAFTEQMDPTG
PWFLGDQISLVDISLAPWAKRLWLIDHYKPGGLGIPKDGDSVWGRWKTWMDAVENRESVK
ATWSADERYLAAYKRYADDTTNSLVGQATRQGNRLP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtcgacacgtcccttccgcctgagacaactggggcggcggcggaactggcc
gcacgccacgccgccaaccacccgctcaagctgtacggcggttggttttgcccgttcgtg
cagcgctcctggatcgttctggtggagaagcgcatcccgcaccagtatgtcgagatcaat
ccgtacaacaaggaggccagctttcttgccatgaacccgcgcggcctggtccccacgctg
gcggtgcccgtcgatgcaagtggccagaagcagaagccgctgttcgagagcagcatcatc
tccgagtatctcgacgaggcttatgcggatgaggggaagcatgggccctctttgcttccc
aaggagccgtacgagaaggcacgggcgcgactgtggatcgaccacatcagcacgcgcatc
atcccggcgttctacaagcttctgcagcacacgcccgagaagccgtatagcattgagctg
gctcgcgatgagctgcatggccatatccgggccttcaccgagcagatggacccgaccggg
ccatggttcctgggcgaccaaattagtctcgtggacataagcctcgcgccatgggcgaag
cgcctgtggctcatcgaccattacaaacccggaggattgggcatcccgaaggacggagat
agcgtctggggccgctggaagacgtggatggatgccgtcgagaatcgtgagagcgtcaag
gcgacctggagtgccgacgagcgttatcttgccgcgtacaagaggtatgccgatgacacc
acgaactcgcttgtcggacaggccacgcggcagggcaaccgacttccatag

DBGET integrated database retrieval system