KEGG   Purpureocillium lilacinum: VFPFJ_09184Help
Entry
VFPFJ_09184       CDS       T05029                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
plj  Purpureocillium lilacinum
Pathway
plj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:plj00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    VFPFJ_09184
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VFPFJ_09184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 28891306
NCBI-ProteinID: XP_018174574
UniProt: A0A179GD63
LinkDB All DBs
Position
Unknown
AA seq 214 aa AA seqDB search
MSASVYSLPALPYAYDALEPSISAQIMELHHSKHHQTYVNNLNAALRSYATASSSGDIAG
QIALQGAIKFNGGGHINHSLFWENLAPASSSEAGDPQGSAPTLIKEIARTWGGLQEFKTA
FTKVLLGLQGSGWGWMVRDGSQLRIITTKDQDPVVGGEVPILAIDFWEHAYYLQYLNGKA
AYIENIWNVINWKTAEARFNGGSDDAFRVLKSSM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctccgtctacagtctcccagcgcttccatacgcttacgacgccctcgagcct
agcatctccgcccagatcatggagcttcaccactccaagcatcaccagacttacgtcaat
aatcttaacgccgccctcagatcgtacgcgaccgcgagctcatccggagatatcgctggt
cagatcgccctccaaggagccatcaagttcaacggaggcggtcatataaatcactcgctc
ttttgggagaacctggccccggcctcgtcctccgaggccggggatccccagggcagtgcg
cctaccctgatcaaagaaatcgctcggacttgggggggcctccaggagtttaagacggca
ttcacgaaagtgcttctcggactgcagggctcagggtggggctggatggtgcgagacggt
tcacaactacgtattatcacgaccaaggaccaggacccagtcgtaggcggcgaggttccc
attcttgctatagatttctgggagcacgcatactatcttcagtatcttaatggcaaggcg
gcttacatcgagaacatctggaacgtcatcaactggaagaccgccgaggcacgttttaac
ggcggaagcgatgacgcgtttcgtgtactcaagtcgtcaatgtag

DBGET integrated database retrieval system