KEGG   Purpureocillium lilacinum: VFPFJ_09699Help
Entry
VFPFJ_09699       CDS       T05029                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00052  Galactose metabolism
plj00500  Starch and sucrose metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VFPFJ_09699
   00500 Starch and sucrose metabolism
    VFPFJ_09699
Enzymes [BR:plj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     VFPFJ_09699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 28891817
NCBI-ProteinID: XP_018175088
UniProt: A0A179GTL5
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MRFWSGLVCAGLASATALSSRNGGNLDACPGYKASNVKKTGNGLKADLTLAGKACNAYGT
DLKHLTLEVSYETDDRIHVTIQDKDNQVYQVPESVFKRPGGKSSAGSNKLKFDYTESPFS
FKVSRADSKEILFDTSAASLVFESQYLRLRTSLPQDPYLYGLGEHSDPLRLQTKNYIRTM
WNQDSYGLPNNSNLYGTHPFYLEQRKGGSHGVFLLNSNGMDIFIDQTSSGKQYLEYNTLG
GVFDFWFVAGPSPTDVVKQYGKIAGTPALQPYWGLGFHQCRYGYQDAYNVAEVVQNYSLA
KIPLETMWTDIDYMDRRRVFSLDPDRFPLKKMRELVSHLHKNDQHYIVMVDPAVAYQDYP
PLHAGVKDDIFLRRDNGSLWLGVVWPGVTVFPDWFSKNIQKYWDGQFQSFFNKDTGVDID
ALWIDMNEPSNFPCNFPCDNPYEAAKGFPPPAPPVRQPPRPLPGWPCDFQPPGTCKRSEV
EERDVPTLEARVPQPAVHDSLPQAERRAAGDQKGLPGRDLLYPKYAIHNKAAYRDDWNAD
KGGISNHTVNTNLIHQNGLAMYDTHNMYGSMMSTASHDAMLSRRPGLRPLIITRSTFSGA
GTKVGHWLGDNLSTWDMYRNSIRAMLAFTGLFQFSMVGSDACGFGGDTTEELCARWAALA
AFSTFFRNHNAEGQISQEFYVWDTVASSARKAIDIRYRLLDYIYTAMYRANDDGRPAVQP
IFYKYPEDKATWALELQYFYGDSVLVAPVTAQGATSVEVYLPDDTFYDWYSHKPILGEAA
THKFIEQDTTTIPLLIRSGAIIPARANSTYTTTELRKQDFELLVALDAHGKAKGELYLDD
GVSIDQKGRYSLVSFSYDKGTVTFDGKFGYDGPATVSKITVLGGGCKPRPGKREHTTGGD
KKYSKTYKVHVKLNKPGSVKVGGK
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctggagcggacttgtctgcgcgggcctcgcgtccgcgacggccttatcaagc
aggaacggtggcaacctcgacgcctgccctggctacaaggcttccaacgtgaagaagact
ggcaatggcctcaaggccgacctgacgcttgccggcaaggcgtgcaacgcctatggcacc
gacctgaagcatctcacacttgaggtctcatacgaaacagatgaccgcattcacgtcacg
attcaggacaaggacaaccaagtctaccaggtccctgaatccgtcttcaagcggccagga
ggcaagagctccgccgggtccaacaaactcaagtttgactacaccgagtcgcccttctcc
ttcaaggtcagccgcgccgactccaaggagattctcttcgatacttcggcggcgtcgctc
gtgttcgagtcgcagtacctgcgccttcggaccagcctgccccaagacccctatctctac
ggcctgggcgagcactcggatcctctgaggctccagaccaagaactacattcgcacaatg
tggaaccaggacagctacggactgcccaacaactccaacctctacggcactcaccccttc
tatctcgagcagcgaaagggcggttcccatggcgtcttccttctcaactccaacggaatg
gacattttcattgaccagacctcgagcggaaagcagtacctcgagtacaacaccctgggc
ggcgtcttcgacttttggttcgttgctggacccagccctaccgacgtcgtcaagcagtac
ggcaagattgccggcacccccgcgctgcagccgtactggggtctgggctttcaccagtgc
cgatacggttaccaggatgcttacaacgtcgccgaggttgtccagaactacagcctggcc
aagatccccctggagaccatgtggaccgacatcgactacatggaccgacgccgcgtcttc
tccctggaccctgatcgctttccgctcaagaagatgcgcgagctcgtatctcaccttcac
aagaacgaccagcactacattgtcatggttgaccctgccgttgcctaccaagattatccc
cctctgcatgcaggagtcaaggatgacatctttctgcgccgcgacaacgggtctctctgg
ctcggcgtagtctggcccggcgtgaccgtgttccccgactggttctccaagaacatccag
aagtactgggacgggcagttccagagcttcttcaacaaggacacgggagtcgacattgac
gccttgtggattgatatgaacgagccaagcaacttcccttgcaacttcccgtgcgacaac
ccctatgaggcagccaagggcttccctcccccagcgcctcctgttcgccagccacctcgt
cccctgcctggatggccctgcgatttccagcctccgggcacttgcaagcgctccgaggtt
gaggaacgagatgtgcccacgctcgaggctcgcgttccccagcctgcggtccacgacagc
ctcccccaggcagagcgccgcgccgcgggcgatcaaaagggcctccctggacgcgacctc
ctgtatcccaagtacgcaatccacaataaggccgcctaccgcgatgattggaacgccgac
aagggcggcatctccaaccacactgtcaacacgaacctgatccaccagaacggcctggcc
atgtacgacacccacaacatgtatggatccatgatgtccaccgcctcgcacgacgccatg
ctttcccgccgtcccggtctccggcccctgatcatcacccgaagcacgttctccggtgcg
ggcaccaaggttggccactggctcggcgacaacctgtccacctgggacatgtaccgcaac
tcgatccgcgccatgctggccttcaccggactcttccagttctccatggtgggctcggat
gcgtgcggcttcggcggcgacaccaccgaagagctctgcgcgcgatgggctgcgctcgcg
gccttttcgacctttttccgcaaccacaacgccgagggccagatcagccaggagttttac
gtctgggacacggtggcgagcagcgcccgcaaggccattgacatccgctaccgcctcctc
gactacatctacacggccatgtaccgcgccaacgacgacggccgccccgcggtgcagccc
atcttctacaagtacccagaggacaaggccacctgggcgctggagctgcagtacttttac
ggcgacagcgtgctcgtcgcgcccgtcacggcgcagggcgcgaccagcgtcgaggtgtac
ctccccgacgacaccttctacgactggtactcgcacaagcccatcctcggcgaggcggcg
acgcacaagttcatcgagcaggacacgacgacgatcccgctcctcatccgctccggcgcc
atcatccccgcgcgcgccaactcgacgtacacgacgacggagctgcgcaagcaggacttt
gagctgctcgtcgcgctcgacgcccacggcaaggccaagggcgagctgtacctcgacgac
ggcgtctccatcgaccagaagggccggtactccctcgtcagcttctcctacgacaagggc
accgtcacctttgacggcaagtttggctacgacggccccgccaccgtctccaagattacc
gtcctcggcggagggtgcaagccccgccccggcaagcgtgagcacaccaccggtggcgac
aagaagtacagcaagacgtacaaggtccacgtcaagctcaacaagcctggcagcgtcaag
gttggcggcaagtga

DBGET integrated database retrieval system