KEGG   Plantactinospora sp. KBS50: CIK06_02645Help
Entry
CIK06_02645       CDS       T05048                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:plk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CIK06_02645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:plk03400]
    CIK06_02645
Enzymes [BR:plk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CIK06_02645
DNA repair and recombination proteins [BR:plk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CIK06_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASW53319
UniProt: A0A248YI98
LinkDB All DBs
Position
586866..587774
Genome map
AA seq 302 aa AA seqDB search
MPAERVRVRVAGRELELSNLDKVLYPAAGFTKGEVIDYYTRIAPVLLPHLRDRPLTRIRF
PNGVDGASFFEKNKPAATPGWVRVVRLPAPGSSKGRETIEYVVGDDLPTLVWLANLAALE
LHTPQWRIGRHPDMLVVDLDPGAPAGLAECCAVAVRMRDRLAADGIASHPKTSGRKGMQL
CCPIAGEQSADEVSGYARRIAGELENADPRLVTAKMAKKLRPGKVFIDWSQNSAAKTTVT
AYSLRAAARPTVSTPLTWDEVEDAVAAGGAVRQFTAAEVLARVDGYGDLMADLLDGGPRV
PG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgagcgggtacgggtcagggtggccggccgcgagctggagctgtccaatctg
gacaaggtgctgtatccggccgcgggcttcaccaagggcgaggtgatcgactactacacc
cggatcgcgccggtgttgctgccccacctgcgggaccggccgctgacccggatccgcttc
cccaacggggtcgacggcgcgtcgttcttcgagaagaacaagccggcggccacgcccggc
tgggtgcgggtggtccggctgccggcgccgggttcgtcgaagggccgggagaccatcgag
tacgtggtgggcgacgacctgccgacgctggtgtggctggccaatctcgcggcgttggag
ctgcacacgccacagtggcggatcggccggcaccccgacatgctggtggtggacctcgat
ccgggggcgccggccgggctggccgagtgctgcgcggtggcggtccggatgcgggaccgg
ctggccgccgacggcatcgccagccatccgaagacctccggcaggaagggcatgcagctg
tgctgcccgatcgccggcgagcagtcggccgacgaggtgtccgggtacgcccggcggatc
gccggcgagctggagaacgccgacccccggctcgtcaccgcgaagatggcgaagaagctg
cggccgggcaaggtgttcatcgactggagtcagaacagcgcggccaagacgacggtgacc
gcctactcgctgcgggccgcggcccggcccaccgtgtccaccccgctgacctgggacgag
gtcgaggacgcggtcgccgccggcggggccgtccggcagttcaccgccgccgaggtgctg
gcccgggtggacgggtacggcgacctgatggccgatctgctcgacggcggtccgcgggta
cccggttga

DBGET integrated database retrieval system