KEGG   Plantactinospora sp. KBS50: CIK06_04780Help
Entry
CIK06_04780       CDS       T05048                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk00020  Citrate cycle (TCA cycle)
plk00480  Glutathione metabolism
plk01100  Metabolic pathways
plk01110  Biosynthesis of secondary metabolites
plk01120  Microbial metabolism in diverse environments
plk01130  Biosynthesis of antibiotics
plk01200  Carbon metabolism
plk01210  2-Oxocarboxylic acid metabolism
plk01230  Biosynthesis of amino acids
Module
plk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:plk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIK06_04780
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CIK06_04780
Enzymes [BR:plk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CIK06_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASW53655
UniProt: A0A248YJ49
LinkDB All DBs
Position
1023829..1025046
Genome map
AA seq 405 aa AA seqDB search
MAKIKVTNPVVELDGDEMTRIIWKQIREQLILPYLDVDLHYYDLSIQHRDATDDQVTVDA
ANAIKQHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYRASDFVVPGPGTVTITYTPADGGEPIEMEVAKFPGGGVAMG
MYNYDDSIRDFARASLRYGLDRGYPVYLSTKNTILKAYDGRFKDIFAEVYENEFKAEFDA
AGISYEHRLIDDMVAAALKWEGGFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGR
TVEAEAAHGTVTRHYRQWQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVSEFADTLEQ
VIVDTVEGGQMTKDLALLISRDAPWLTSDEFMAALDGNLAERLNG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaccaacccggtcgtagagctcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagttgatcctgccctacctcgacgtcgacctgcac
tactacgacctgtcgatccagcaccgcgacgccaccgacgaccaggtgaccgtcgacgcg
gcgaacgccatcaagcagcacggcgtgggcgtgaagtgcgcgacgatcaccccggacgag
gcccgggtcgaggagttcggcctcaagaagatgtggcgttcgcccaacggcacgatccgg
aacatcctcggcggcgtcgtcttccgcgagccgatcatcatgtcgaacgtgccccgcctg
gtacccggctggaccaagccgatcatcatcggccggcacgcgcacggcgaccagtaccgg
gccagcgacttcgtcgtccccggccccggcacggtgacgatcacctacaccccggccgac
ggcggcgagccgatcgagatggaggtcgccaagttccccggcggcggcgtcgcgatgggc
atgtacaactacgacgacagcatccgggacttcgcccgggccagcctgcggtacggcctg
gaccgcggctacccggtctacctgtccaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttcgccgaggtgtacgagaacgagttcaaggccgagttcgacgcg
gccggcatcagctacgagcaccggctgatcgacgacatggtggccgccgcgctcaagtgg
gagggcggcttcgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacctcggtgctgatgaccccggacggccgg
acggtcgaggccgaggccgcgcacggcaccgtcacccggcactaccggcagtggcagaag
ggcgagaagacctcgaccaacccgatcgcgtccatctacgcctggacccgggggctggcc
caccgcggcaagctggacggcaccccggcggtgtccgagttcgcggacaccctggaacag
gtcatcgtggacaccgtcgagggcggccagatgaccaaggacctggcgctgctgatctcc
cgcgacgcaccgtggctgaccagcgacgagttcatggccgccctggacgggaacctggcc
gagcggctcaacggctga

DBGET integrated database retrieval system