KEGG   Plantactinospora sp. KBS50: CIK06_08405Help
Entry
CIK06_08405       CDS       T05048                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
plk  Plantactinospora sp. KBS50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ASW54215
UniProt: A0A248YKR1
LinkDB All DBs
Position
complement(1856012..1857082)
Genome map
AA seq 356 aa AA seqDB search
MELPVMPPVAPMLAKPVGEIPGGRLYEPKWDGFRSIIFRDGDEVEIGSRNERPMTRYFPE
VVRAVLANFPPRAVIDGEIVVADTGRNTLDFEALQQRIHPAASRVNLLAEQTPASFVAFD
LLALDRDDLTGRPFAERRELLERALAEAEPPVHVTPITSDEATARRWFAEFEGAGLDGLI
AKGPDLAYQPDKRVMIKIKHKRTADCVLAGYRLHKSGDDRIGSLLLGLYDDERDVLVSVG
VIGAFPMATRKALFTELQPLVTGFEEHPWNWAAHTSGERTPRRNEQSRWNAGKDLSFVPL
RPERVVEVRYDYMEGERFRHTTQFERWRPDRDPRTCTYAQLDRPVRFNLADVLSGG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaactgccggtcatgccccccgtcgccccgatgctcgcgaagccggtcggggagatc
ccgggcgggcggctgtacgagcccaagtgggacggcttccggtccatcatcttccgcgac
ggcgacgaggtggagatcggcagccggaacgagcggccgatgacgcgctacttccccgag
gtcgtccgggcggtgctggccaacttcccgccccgcgcggtgatcgacggggagatcgtg
gtggccgacaccgggcgcaacaccctggatttcgaggcgctccagcagcggatccatccg
gcggccagccgggtgaacctgctggccgagcagaccccggccagcttcgtcgcgttcgac
ctgctggcgctggaccgcgacgacctgaccgggcggccgttcgccgagcgccgcgagctg
ctcgaacgggccctggccgaggcggagccgccggtgcacgtcacgccgatcaccagcgac
gaggccacggcccgccgctggttcgccgagttcgagggcgccggcctggacgggctcatc
gccaagggtcccgatctggcctaccagcccgacaagcgggtcatgatcaagatcaagcac
aagcgtacggcggactgcgtgctggccggctaccggctgcacaagtcgggcgacgaccgg
atcggctcgctgctgctcggcctctacgacgacgagcgggacgtgctggtctcggtgggg
gtgatcggggcgttcccgatggccacccgcaaggcgctgttcaccgagctccagccgctg
gtcaccggcttcgaggagcacccgtggaactgggccgcgcacaccagcggggaacggacc
ccgcggcgcaacgagcagagccggtggaacgccggcaaggacctctcgttcgtgccgttg
cgcccggaacgggtggtcgaggtccggtacgactacatggagggcgaacgattccggcat
accacccagttcgaacggtggcgcccggaccgtgatccccggacctgcacgtacgcccag
ctcgaccggccggtgcggttcaacctcgccgacgtcctctccggcggctga

DBGET integrated database retrieval system