KEGG   Plantactinospora sp. KBS50: CIK06_09130Help
Entry
CIK06_09130       CDS       T05048                                 

Definition
(GenBank) hypothetical protein
Organism
plk  Plantactinospora sp. KBS50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding DUF2510
Motif
Other DBs
NCBI-ProteinID: ASW54320
UniProt: A0A248YL93
LinkDB All DBs
Position
complement(2047348..2050932)
Genome map
AA seq 1194 aa AA seqDB search
MAGREHTCTDLSGTGMTVSGLLHRRAADQPDRIGYTFLLDGEGEEQPLTYAGTDLRARAV
AASLRAAGARPGSRALLVLPPGLDYLTALFGCLYAGVVAVPVYPPDPVRLTTSLPRLLAI
VRDAEPEVAVTTSPLLGFLDQVTGLAPELGALRWVAADTAEAGDAETGTPVPVAADATAI
LQYTSGSTADPRGVRLSHHNLLHNSDLIQRLFGTTPESRGMVWLPPYHDMGLIGGLLQPL
YGGFPITLMSPLDFLADPMRWLRAIDRSGATVSGGPNFAYDLCARKCDPQEAARLDLRSW
RVAFNGAEPIRPETLERFAATFEPAGFHPDAFLPCYGLAEATLIVSGHGGRSAPATTTGA
PPTVTVDRTALERHDAAAPGAGPAARLTSCGPSAPGLRIEIVDPATATGCPPGRVGEIWV
SGASVAGGYWRRPEETERTFRARLAGTDGPPFLRTGDLGFLHDGQLVVTGRLKDLIIVRG
QNHYPQDIERTAEQVDPVLRPGCTAAFLLGDEDDRPVLVHEIRRGSEGVDVADLATRIRQ
AVARQHGLDVRAVVLVRAGGMPKTSSGKVQRRLCRSRLRSGDLPEVGRDETPAPPAGTAG
TGTADGGDGPAGAAVPAAQVLAAPPEQRPELLERYLRGRLAEVTGAAPADRNQPLLAVGL
DSLAVVQLKHRVDSELGVSLPLPALLSGAGLAEVAGRLAEQLGAAGPTVTAAGTTARTTD
PAAEAAQSGEADPAADPARTGDPAADPARTGVPAGEAVEVAPMSAGQRWTWFLHQIEPDS
TAFTIAVALRVLDPLDGAALHRALDTLVARHAALRTTFQVRNGEPVQVVAPSGSAGYREH
DAGRLDEGTLRTVLTRVARTPFDLASGPLLRVDRYRRPTGDVLLLSMDHMVTDFWSLTVL
ARELGALYQAYTSGGDVPLDPPAASYADAARWQRSLLEDPAAVQRLTRYWDGQLAGAVPR
LALPPARAGGGRGARRFAVPAPLAAQLRDRACADRVTLYVLLLASFQAVLHRVTGQPDLV
VGIGVAGRTRPEFADVVGCFTRPVIVRSHCADGEPFPALLARTRDGVIGALEHQDYPMAM
LAARRKLAPHTPLYDVLFTFNRSPRHGDDLATLAAVGPAGVRRTLGPLRVESFPLPAEPS
ALPVELVMAELDGVPHGVLRYRADALDDATADDLVAGFLGHLAEVAEGLVPQTA
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
gtggccggccgggaacacacctgcaccgacctgtccgggaccggcatgaccgtctccgga
ctgctgcaccgccgggcggccgaccagcccgaccggatcggctacaccttcctgctcgac
ggcgagggcgaggagcagccgctcacgtacgccgggaccgacctgcgggcgcgggccgtg
gccgcgagcctgcgggccgccggcgcccggccgggcagccgggcgttgctggtgctgccg
cccggactggactacctcacggccctcttcggctgcctgtacgccggtgtggtggccgtg
ccggtgtatccgcccgacccggtcaggctcaccaccagcctgccccggttgctggccatc
gtgcgcgacgccgaaccggaggtggcggtgaccacctccccgctgctcggcttcctcgac
caggtcaccgggctggcgcccgaactgggcgcgctgcgctgggtcgccgccgacacggcc
gaggccggcgacgccgagaccggtacgccggtgcccgtggccgcggacgccaccgcgatc
ctccagtacacctcggggtcgaccgccgacccgcgcggcgtgcggctgtcgcaccacaac
ctgctgcacaactcggacctcatccagcggctgttcggcaccacgccggagagccgcggc
atggtctggctgccgccgtatcacgacatgggcctgatcggtggcctgctccagccgctg
tacggcggcttcccgatcaccctgatgtcgccgctggacttcctcgccgacccgatgcgc
tggctgcgggccatcgaccggtccggcgcgacggtcagcggcggccccaacttcgcctac
gacctgtgcgcccgcaagtgcgacccgcaggaggccgcgcggctggacctgcggtcctgg
cgggtcgcgttcaacggcgccgagccgatccggcccgagacgctcgaacggttcgccgcc
acgttcgagcccgcgggcttccaccccgacgcgttcctgccctgctacggcctggccgag
gccaccctgatcgtctccgggcacggcggccggtcggcgccggcgaccaccaccggtgcc
ccgccgaccgtcacggtcgaccgcacggcactcgaacggcacgacgccgcggcgcccggc
gccggtccggcggcccggctcaccagttgcggaccgtcggcgccggggctgcggatcgag
atcgtcgacccggccaccgcgaccggctgcccgccgggccgggtgggcgagatctgggtg
tccggcgcgagcgtggccggcggctactggcgccggccggaggagaccgagcggaccttc
cgggcccgactcgccggcacggacggcccgcccttcctgcgcaccggcgacctcggcttc
ctgcacgacgggcagctcgtggtcaccggccggctcaaggacctgatcatcgtccgcggc
cagaaccactacccgcaggacatcgaacgcaccgcggagcaggtggacccggtgctgcgg
cccggctgcaccgccgccttcctgctcggcgacgaggacgaccggccggtgctggtgcac
gagatccggcgcgggtcggagggggtcgacgtcgccgacctggcgacccggatccggcag
gcggtggcccggcagcacggcctcgacgtgcgcgccgtcgtgctggtgcgggccggcggc
atgccgaagacctccagcggcaaggtgcagcgccggctgtgccgctcgcggctgcgctcc
ggcgaccttcccgaggtcgggcgggacgagacgccggccccacccgccggcaccgccggc
accggcaccgccgacggtggcgacggcccggccggggcggccgtgccggcggcgcaggtc
ctggccgccccgcccgagcagcggcccgagctgctggaacgctacctgcgcggccggctc
gccgaggtgaccggcgccgcgcccgccgaccggaaccagccgttgctggccgtcgggctc
gactcgctggccgtcgtccagctcaagcaccgggtggacagcgagctgggggtcagcctg
ccgctaccggcgctgctgtccggtgccgggctggccgaggtcgccggccggctcgccgag
cagctcggcgcggccggcccgacggtgaccgccgccggcacgaccgcgcggaccaccgac
ccggccgccgaggccgcgcagagcggtgaggccgacccggccgcggacccggcgcggacc
ggcgacccggccgcggacccggcgcggaccggcgtaccggccggtgaggcggtcgaggtc
gcgcccatgtcggccgggcaacggtggacctggttcctgcaccagatcgagccggacagc
accgccttcaccatcgcggtggcgctgcgcgtactcgacccgctcgacggcgccgcgctg
caccgcgccctggacaccctggtggcccggcacgcggcgctgcgcaccacgttccaggtc
cgcaacggcgaaccggtccaggtggtcgcgccgagcgggtcggccggctaccgggaacac
gacgccgggcggctcgacgagggcaccctgcggaccgtgctgacccgcgtcgcgcgtacc
cccttcgacctggcctccgggccgctgctgcgggtcgaccgctaccgccggcccaccggc
gacgtcctgctgctgagcatggaccacatggtgaccgacttctggtcgctgaccgtcctg
gcccgggaactcggcgcgctctaccaggcgtacaccagcggtggcgacgtcccgctcgac
ccgccggccgccagctacgcggacgccgcgcggtggcagcgctcgctgctggaggatccg
gcggccgtgcagcggctgacccggtactgggacggccaactggccggcgcggtgccccgg
ctggcgctgccgccggcgcgggccggcggcggccggggggcgcggcgcttcgcggtgccg
gccccgctggccgcccaactgcgcgaccgcgcctgcgccgaccgggtcaccctctacgtg
ctgctgctggcctcgttccaggccgtgctgcaccgggtcaccggccagcccgacctggtt
gtcggcatcggggtggccgggcgtacccggccggagttcgccgacgtcgtcggctgcttc
acccggccggtcatcgtgcgcagccactgcgcggacggcgagcccttcccggcgctgctg
gcccggacccgggacggcgtcatcggcgcgctggagcaccaggactacccgatggcgatg
ctggccgcccgccgcaagctggccccgcacacgccgctgtacgacgtgctgttcaccttc
aaccggtcaccccggcacggcgacgacctcgccacgctggccgccgtcggccccgccggg
gtacggcgcaccctcgggccgctgcgcgtcgagagcttcccgctgccggccgaaccgagt
gcgctgccggtcgagctggtgatggcggagctggacggggtgccgcacggcgtgctgcgc
taccgggccgacgcgctcgacgacgcgaccgcggacgacctggtggcgggcttcctcggc
cacctggcggaggtggccgagggtctggtgccgcagacggcctga

DBGET integrated database retrieval system