KEGG   Plantactinospora sp. KBS50: CIK06_21945
Entry
CIK06_21945       CDS       T05048                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk00900  Terpenoid backbone biosynthesis
plk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CIK06_21945
Enzymes [BR:plk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     CIK06_21945
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ASW56250
UniProt: A0A248YRU0
LinkDB
Position
complement(5110389..5111201)
AA seq 270 aa
MIRSMTRREHREPVPPTPHPSGARPPALPAEALPRHVAVVMDGNGRWAKDRGLPRTKGHE
AGEFSLFDTIEGAIELGIPYLSAYAFSTENWRRSPDEVRFLMGFNREVIRRRRDQLVDLG
VRVVWSGRTGRLWKSVISELQTAEEMSRQNSTLTLQFCVNYGGQAEIADATAAIAREVAA
GRLHPDRITEKTIARHLYHPEVPEVDLFLRPSGEQRLSNFLLWQSAYAELVVLDTLWPDF
DRRHLWYACELYAQRDRRFGGALPNPVPPS
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgatccgatccatgacccggcgcgagcaccgcgagccggtgccgcccaccccgcacccc
tccggcgcccgcccaccggccctgccggccgaggccctgccgcggcacgtggccgtggtg
atggacggcaacggccggtgggccaaggaccgtggcctgccgcgcaccaaggggcacgag
gcgggggagttctccctcttcgacaccatcgagggcgccatcgagctgggcatcccgtac
ctgtcggcgtacgccttctccaccgagaactggcggcggtcgccggacgaggtgcggttc
ctgatggggttcaaccgcgaggtgatccggcgccgccgcgaccagctcgtcgacctcggc
gtccgggtggtctggtcgggccggaccgggcggctgtggaagagcgtgatcagcgaactc
cagaccgccgaggagatgtcccggcagaactcgacgctgaccctccagttctgcgtcaac
tacggcgggcaggccgagatcgccgacgccaccgcggcgatagcccgggaggtggcggcc
ggccggctgcatccggaccggatcaccgagaagaccatcgcgcggcacctctaccacccc
gaggtgcccgaggtcgacctgttcctgcgcccgtccggggagcagcgactctccaacttc
ctgctgtggcagtccgcgtacgccgaactggtggtgctggacacgctctggccggacttc
gaccggcggcacctgtggtacgcctgcgagctgtacgcgcagcgggaccgccggttcggc
ggcgcgctgccgaacccggtcccgccgagctga

DBGET integrated database retrieval system