KEGG   Plantactinospora sp. KBS50: CIK06_24020Help
Entry
CIK06_24020       CDS       T05048                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
plk  Plantactinospora sp. KBS50
Brite
KEGG Orthology (KO) [BR:plk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIK06_24020 (sodN)
Enzymes [BR:plk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CIK06_24020 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ASW56567
UniProt: A0A248YT29
LinkDB All DBs
Position
5582780..5583187
Genome map
AA seq 135 aa AA seqDB search
MRLPRILTPRFVASAHCDLPCGVYDPAQARIEAESVKAICEKYQANTDAEFRTRALIIKE
QRSELVKHHLWVLWTDYFKPAHFEKYPHLHQLFNEATKLAGGGGGAKASTDPAKADELLA
KIDEISKIFWETKQA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccccgcatcctcacgccacgtttcgttgccagtgcccactgcgacctgccg
tgcggtgtgtacgacccggcgcaggcccggatcgaagccgagtcggtcaaggcgatctgc
gagaagtaccaggcgaacaccgacgccgagttccgcacccgggcgctgatcatcaaggag
cagcgttccgagctggtcaagcaccacctctgggtgctctggaccgactacttcaagccg
gcgcacttcgagaagtacccgcacctgcaccagcttttcaacgaggccaccaagctggcc
ggcggtggcggcggcgccaaggcgtccacggaccccgccaaggccgacgagctgctggcc
aagatcgacgagatctccaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system