KEGG   Planococcus versutus: I858_002360Help
Entry
I858_002360       CDS       T04421                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
pll  Planococcus versutus
Pathway
pll00071  Fatty acid degradation
pll00280  Valine, leucine and isoleucine degradation
pll00281  Geraniol degradation
pll00362  Benzoate degradation
pll00592  alpha-Linolenic acid metabolism
pll01100  Metabolic pathways
pll01110  Biosynthesis of secondary metabolites
pll01120  Microbial metabolism in diverse environments
pll01130  Biosynthesis of antibiotics
pll01212  Fatty acid metabolism
Module
pll_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I858_002360
   00592 alpha-Linolenic acid metabolism
    I858_002360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I858_002360
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    I858_002360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I858_002360
   00642 Ethylbenzene degradation
    I858_002360
Enzymes [BR:pll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     I858_002360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU25897
UniProt: A0A1B1RY96
LinkDB All DBs
Position
1092349..1093524
Genome map
AA seq 391 aa AA seqDB search
MREAVIVASARTPVGKAGKGSLVTVRPDDFGALVVKETLQRADGYDGPIDDLIMGCAMPE
AEQGMNIARNIGALAGLPDTVSAVTVNRFCSSGLQSIAYAAERIMVGSAEAIIAGGVESM
SMVPMMGNVIRPNAKLAETAPQYYMSMGHTAEQVATKYGVSREDQDAFAVRSHEKAAAAI
AAGHFDEEIVPVEVTKRYVDENNKYQENTSMFEMDEGVRHGTNTVGLSKLRAAFSARGSV
TAGNSSQTSDGAGALLVMDREKAEALGLKPIAKFRSFATGGVPPEIMGIGPVVAIPKALK
LAGLTIDDIDVWELNEAFASQSLGVIRELGLDIDKVNFNGGAIALGHPLGATGSILTIRM
MSELKRQGKQFGVVTMCIGGGMGAAGVFEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagcagtaattgtggccagtgctcgcacaccggtcggaaaagcgggaaaaggt
tctttagtaactgtgcgtccagacgattttggcgccttggttgtcaaagaaacattacaa
cgggcagatggctatgatggtccgatagacgatttgattatgggctgtgcaatgccagaa
gcggaacaaggcatgaacattgcacgcaacattggagcacttgcaggactgccagatacg
gtatctgctgtaacggtaaatcgattttgttcatcaggtcttcaatcgatcgcttatgca
gcagaacgcatcatggtcggatcagctgaagcgattatcgctggcggtgtcgaatctatg
agcatggtaccgatgatggggaacgtcattcgacctaacgcaaaactggcggaaacagct
cctcagtattacatgagcatgggacatacagctgagcaagttgcgacgaaatacggtgtg
agccgtgaagaccaagatgcatttgctgttcgttcacatgaaaaagctgctgctgccatt
gcagctggacactttgatgaggaaattgtaccggtcgaagtaacaaagcgttatgtcgat
gaaaacaataaataccaagagaacacctcaatgtttgaaatggacgaaggcgttcgtcac
gggaccaatactgtaggactcagcaaattacgtgcagcgttttcagcacggggctctgtg
acagctggaaactcatcgcaaacttcagatggtgcaggtgcattacttgttatggatcgt
gaaaaagcggaagcacttggtctcaagcccatcgccaaattccgctcatttgcaacagga
ggcgtgccaccagaaattatggggattggcccagtggtggcaattccaaaagcattaaaa
ctagctggactgactattgatgacattgatgtatgggaactaaacgaagccttcgcttcg
caatcacttggagttatccgtgaactgggtcttgatatcgacaaggtcaactttaacggg
ggtgccatcgcactcggtcacccacttggtgcaacaggctccattttaaccattcgcatg
atgagtgagttaaaacgacaaggcaaacaatttggtgttgtaaccatgtgtatcggcgga
ggaatgggcgcagcaggcgtctttgaaatgctatag

DBGET integrated database retrieval system