KEGG   Planococcus versutus: I858_012385Help
Entry
I858_012385       CDS       T04421                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pll  Planococcus versutus
Pathway
pll00061  Fatty acid biosynthesis
pll00780  Biotin metabolism
pll01100  Metabolic pathways
pll01130  Biosynthesis of antibiotics
pll01212  Fatty acid metabolism
Module
pll_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    I858_012385
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    I858_012385
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    I858_012385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pll01004]
    I858_012385
Enzymes [BR:pll01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     I858_012385
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     I858_012385
Lipid biosynthesis proteins [BR:pll01004]
 Fatty acid synthase
  Component type
   I858_012385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ANU27782
UniProt: A0A1B1S3N3
LinkDB All DBs
Position
complement(2288505..2289275)
Genome map
AA seq 256 aa AA seqDB search
MSISLTGKTFVIMGVANKRSIAWGIARALDQSGANLIFTYAGERFEKSVRDLVATLDGNH
ELILPCDVTNDEAVATCFKTIQEQVETIHGLAHCIAFAKSEELAGDFSDTSRDGFLLAHN
ISAYSLTSIAKNAKPLMAEGGSIVALTYIGGERVMPNYNVMGVAKASLEMSVRYLAADLG
KHGIRVNAISSGPIRTLSSKGVSDFNSILHEIEEKAPLRRNTTPEEVGDTAAFLFSDMSR
GITGETIHVDSGFHIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatcattaacaggaaagacttttgtcattatgggagtagccaacaagcgaagc
attgcttggggaatcgcgcgtgcgttagatcaatcgggggccaacttgattttcacctat
gcaggagagcgctttgagaaatcagtgcgggatttggtcgcaacattagatggtaaccac
gaattgattttgccatgtgacgtaacaaacgatgaagcagtagctacatgctttaaaacg
attcaagaacaagttgaaacaattcacggattagcgcattgtatcgcttttgccaaaagc
gaagagctagcaggtgacttttcagatacatcacgagatggttttttactagcacataat
attagtgcttactcgttaacaagcattgcaaaaaatgcgaaaccgttgatggcagaaggt
ggcagcattgtagctttaacgtacattggtggagaacgtgtcatgccaaactataacgtc
atgggtgttgcaaaagcatctcttgaaatgtctgtccgttatttggcagcagaccttggc
aaacacggtattcgtgtcaatgcgatttcttcaggaccgattcgtacactatcttcaaaa
ggtgtcagtgattttaactccatcttgcatgagattgaagaaaaagcaccattgcgtcgc
aatacaacgcctgaagaagtgggcgatacagcagctttccttttcagcgatatgtctcgc
ggaattacaggagaaaccattcatgtagatagtggattccatattttataa

DBGET integrated database retrieval system