KEGG   Planococcus versutus: I858_013160Help
Entry
I858_013160       CDS       T04421                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pll  Planococcus versutus
Brite
KEGG Orthology (KO) [BR:pll00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pll01001]
    I858_013160
Enzymes [BR:pll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     I858_013160
Protein kinases [BR:pll01001]
 Serine/threonine kinases: Other
  Bacterial family
   I858_013160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Seadorna_VP7 Pkinase_fungal Kdo Haspin_kinase FTA2
Motif
Other DBs
NCBI-ProteinID: ANU27936
UniProt: A0A1B1S416
LinkDB All DBs
Position
complement(2130758..2132731)
Genome map
AA seq 657 aa AA seqDB search
MLIGKNINGRYKIKELIGSGGMSNVYLAHDIILDRDIAIKILRYDFSNEEELRRRFQREA
LSTTSLAHPNIVNIFDVGEDGSIHYLVMEYVPGETLKEYIIEHSPVSSERAVEIMRQLTS
ALAHAHHNQIVHRDIKPQNVLMDAEGNVKISDFGIAMALSATSYTQTNSVLGTVHYLSPE
QARGGTANKKSDIYSLGIVMYELITGKLPFSGESAVSIALKHLQTETPSLRETVPTLPQS
LENIVLKATAKNIEHRYQSADEMEEDLETALLPERLNEPKFVVPVDEGATRAMPAIKNSV
ASMDPIETKTMPLPLNEAKKVQKVPEKKKKKKWPWVVGILAFLLVLGLIQAIAFPGLFAP
RQVAVPDVSEVERTEAIEELQATGFTVGEETEEFSEEIASNHIIRTIPEAGKMRDRETAV
QLFISKGKEKVEMNNFVGSTLEEATKELVTKNFEPANATEEFSDEPEGTILNQRPAAGEE
VIVSETTVEFIVSKGKDMRAVENLAGFTEANLNDYARSSGFNIRIISEQASDKVEAGKVM
SQTPAAGEQLVAGSTIEVTLSSGMAEQAMKTFVDTIEIPYEPAEAAKEGEEPVEQTIQIY
VQDNTQTMVEPAEKFKITENKTHRIELQIGQGESASYRIVRDATIILEETIDYAEVE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcggtaaaaatatcaacggacgctacaagatcaaagaattaattggtagtggt
ggtatgtctaatgtctatttggcacatgacatcattttagaccgagacatcgcaatcaaa
attttacgttatgatttttcgaatgaagaagaactgcgtagacgcttccaaagagaagcg
ttatctactacgagtttggctcatccgaatattgtcaatattttcgatgtaggtgaagac
ggttcgattcattatttggtgatggaatatgttccaggagaaactttaaaagaatacata
atcgagcattcacctgtttcgtctgagcgggcagtcgagatcatgaggcaattgacatct
gctttagctcacgcccatcacaaccaaattgttcatcgtgacattaaaccgcaaaatgta
ttgatggatgctgaaggcaatgtgaagatatctgattttggcattgcgatggcgttgagt
gcgacttcctatacacaaacaaattcagtgttaggaactgtgcattatttatcgccagaa
caagccagaggtggcacagctaataaaaaatctgatatttattcacttggcatcgtgatg
tatgaattgattacagggaaactgccattttcaggtgaatcagccgtgtcgattgcatta
aagcatttgcaaacagaaacgccatccttgcgagaaacggttccaacattgcctcaaagt
ttggagaacattgtattaaaagcgacagcaaaaaacattgaacatcgctatcaatcggca
gatgaaatggaagaagatttggagacggcattgttgccagaacggttaaatgaaccaaag
tttgtcgtgcctgttgacgaaggggctacacgtgcgatgccagcgataaaaaattcagta
gcatccatggatccgatagaaacaaaaacgatgccgttgccgttaaacgaagcgaaaaaa
gtacagaaagttcctgagaaaaagaagaaaaagaaatggccatgggtagtgggcattctt
gcttttcttctagttcttggactgattcaagcaatcgcatttcctggattgtttgcacca
agacaagttgcggtgcctgacgtttcagaagtggaacgaacagaagcgatagaagagctc
caggctacaggttttactgtcggtgaagaaacggaagaattttcagaagaaatagctagc
aatcatattatccggacgattccagaagccggtaaaatgagagaccgcgaaacagcagtt
cagctgtttattagcaaaggcaaagaaaaagttgaaatgaacaacttcgtaggatcaact
cttgaagaagctacaaaagagttggtaacgaaaaattttgaaccagcaaacgctacagaa
gaattttccgatgaacctgaaggtacgattttaaatcagcgacctgcagcaggagaagaa
gtaatcgttagtgagacaactgtagaatttatcgttagcaaaggaaaagacatgcgtgct
gtagaaaatttagctggctttaccgaagcaaatttaaatgattacgcccgatcttcaggc
tttaatattcgcattatttctgaacaagcatctgataaagtcgaagcggggaaagtgatg
tcacaaactccagctgcaggagaacaactagttgccggtagtacgattgaagttacctta
tcttcaggtatggcagaacaagcaatgaaaaccttcgttgatacgatagaaattccttat
gaaccagctgaggctgctaaagaaggcgaagagccggtcgaacaaacgattcaaatttat
gtgcaggataatacacaaaccatggtagaaccggctgaaaaattcaagattacggaaaac
aaaacgcaccgtattgaacttcaaatcggacaaggcgaaagcgcttcttaccgaattgtc
cgagacgctactattattttggaagaaacgattgattatgcagaagtggaataa

DBGET integrated database retrieval system