KEGG   Planctopirus limnophila: Plim_2856Help
Entry
Plim_2856         CDS       T01225                                 

Definition
(GenBank) Neuraminidase (sialidase)-like protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
plm  Planctopirus limnophila
Pathway
plm00511  Other glycan degradation
plm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:plm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Plim_2856
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Plim_2856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:plm02042]
    Plim_2856
Enzymes [BR:plm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Plim_2856
Bacterial toxins [BR:plm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Plim_2856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-ProteinID: ADG68678
UniProt: D5SRI5
LinkDB All DBs
Position
complement(3701355..3702632)
Genome map
AA seq 425 aa AA seqDB search
MNSLVVNSLKTSLLALCSFWVGTITLTPCIAWTLALIAFATPFEFCTSQENPAPLVKGDE
NLFRTVIRRQGDDGIHTYRIPGLATSNKGTLLAVFDNRHKSAVDLPGDIDVGLLRSTDGG
QTWGPLQTIMDYDKSAPNSAGNGVGDPAILVDRETGEIFVTALWSFGKRAWHGSGPGLSP
EETGQLVIASSKDDGLTWSTPVSITSQVKQPAWRLLFQGPGAGIQLQNGTLVFAAQYKGA
DNVVHACLLWSNDHGQSWHLTPPAAASQPATSEAQVAEAADGTLLFTMRNESQRGQRLWS
RFTPGKNSLGDGTWSAPYSQLPDPTCMASIVRHPSGALLFANPASSQKRANMTVRISEDL
GKSWSEGRLIDSRPSAYSCLTVLANGEIGLLYECGDRNAYETLTFARFPLDWLKGEENST
KPSPE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcttgtggtcaactcattgaaaacctccctcctggctttgtgcagtttctgg
gtgggtacgatcactctcactccctgcatcgcgtggacactcgctctcatcgccttcgcc
actcccttcgaattctgcacttcgcaggaaaatcccgctcctcttgtcaaaggcgacgag
aacctcttccgcaccgtcattcgccgacagggagacgacgggattcacacctatcgaatt
cccggcctggccacatcgaacaagggcacgctcctcgcggtcttcgataatcgccacaaa
tcagccgtcgatctcccgggcgatatcgacgtgggactcctccgcagcaccgatggtggc
cagacctgggggccactccaaaccatcatggattacgacaaatcagccccgaactccgct
ggcaatggtgtcggcgatccggccattctcgtcgatcgagagaccggcgaaatcttcgtg
accgcactctggtcgttcggcaaacgagcctggcatggttccggccccggactttccccc
gaagagaccggccaactcgtcatagcctccagcaaagacgatggactcacctggtcaact
cccgtctccatcacgtcacaagtcaagcagcccgcctggcggctgttattccaggggcct
ggagccgggattcaattacaaaacgggacactcgtttttgcggctcaatacaaaggagcc
gacaacgtcgtccatgcctgtctattgtggagtaacgatcacggtcagagctggcacctc
acgcccccggcagccgccagtcagccagccacatctgaagctcaggtggcagaagccgcc
gatgggacactcctcttcacaatgcggaatgaaagccagcgtggtcagagactctggtca
cgtttcacccccggtaaaaactcgctgggcgatggcacatggtcagccccttacagccag
ttgcccgatccgacctgcatggccagcatcgtcaggcatccctccggagcacttctgttc
gcaaaccctgcttcttctcaaaaacgggccaatatgaccgttcgaattagtgaagatctg
ggaaaatcgtggtccgaaggccgactcatcgactcccgaccgagtgcgtactcctgcctc
acagttctcgcgaacggcgaaatcggcctgctctacgaatgcggcgaccgcaacgcttac
gaaacattaaccttcgcccgcttccccctcgactggcttaaaggcgaagaaaactccacg
aaacccagcccagaatga

DBGET integrated database retrieval system