KEGG   Planctopirus limnophila: Plim_3822
Entry
Plim_3822         CDS       T01225                                 

Definition
(GenBank) ATP-binding region ATPase domain protein
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
plm  Planctopirus limnophila
Pathway
plm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Plim_3822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plm01001]
    Plim_3822
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:plm02022]
    Plim_3822
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Plim_3822
Protein kinases [BR:plm01001]
 Histidine kinases
  OmpR family
   Plim_3822
Two-component system [BR:plm02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   Plim_3822
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_2 COX14 UPF0242 Phage_holin_3_6 HATPase_c_5 HEF_HK
Other DBs
NCBI-ProteinID: ADG69634
UniProt: D5SX12
LinkDB
Position
complement(4913793..4914761)
AA seq 322 aa
MSALFRKRRTLHLPITLSVTLIVLNVTLMVVWIVLFAQNTWWAALVLGVVVFTLILTGLS
IYMVLMIKEVRLNQRQANFVDAVTHELKSPIASLSLHLETLSLRSLSDDQRQKFYATMER
ELERLDHLITQLLDVGRLNATGTQAASTDLILDTLLRSVAHEVAGHYRKEVTEIFQFDLD
TAVLRAPQIVVETIFRNLFDNAIKYGGHPPLIFVEVRAVDHARIVIRVTDNGAGVAPEDR
KRIFQMFYRAGNELQRRTKGTGLGLYIVQTLVRQLNGRIHVHPVNNHSWSLSSVRSGLKD
LEGKPLETGTTFELILPGRVII
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagtgccctctttcgaaaacgtcgcacgctgcacctgccgattacactcagcgtgact
ctgatcgtgctgaacgtaactttaatggttgtatggattgtgctgttcgcccagaacaca
tggtgggcagcactcgtgctgggcgtggtggttttcacgctgatactcaccggcctttcc
atctacatggtgctcatgatcaaagaagtcaggctcaatcaaaggcaggccaattttgtc
gatgccgtcactcatgaactgaaatcacccattgcttcactcagtctgcatctggaaacc
ttgagtctgcgcagtctttccgatgatcagaggcagaagttttatgccaccatggaacgc
gaactcgagcgactggatcatctcattacacaactgctcgatgtcggacggctcaatgcg
acggggactcaggccgcttccaccgacttgattctcgatacacttttacgatctgtcgct
catgaggtggcagggcattaccgcaaagaagtcacggagattttccaatttgatcttgat
acagcagtccttcgagcacctcaaattgtcgtagaaaccatatttcggaatctcttcgac
aatgccatcaagtatggtggacatcctccgctgatctttgtcgaagttcgtgcggtggat
catgcccggatcgtgatccgcgtgaccgacaacggagcgggcgtcgcccccgaagatcgc
aagcggatttttcaaatgttctaccgtgcgggtaacgaactgcagagacgaaccaaaggg
acagggctgggtctgtatattgttcagacattagtccggcagttgaatggaagaattcac
gttcacccagtcaataatcactcttggagcctttccagtgtgcgttccgggctgaaagat
ctggaaggcaaacctctggaaacgggcaccaccttcgaattgatccttccaggacgggtc
atcatatga

DBGET integrated database retrieval system