KEGG   Planococcus sp. PAMC 21323: Plano_0029Help
Entry
Plano_0029        CDS       T03510                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pln  Planococcus sp. PAMC 21323
Brite
KEGG Orthology (KO) [BR:pln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pln03012]
    Plano_0029
   03029 Mitochondrial biogenesis [BR:pln03029]
    Plano_0029
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pln04147]
    Plano_0029
Translation factors [BR:pln03012]
 Eukaryotic Type
  Elongation factors
   Plano_0029
 Prokaryotic Type
   Plano_0029
Mitochondrial biogenesis [BR:pln03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Plano_0029
Exosome [BR:pln04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Plano_0029
  Exosomal proteins of breast cancer cells
   Plano_0029
  Exosomal proteins of colorectal cancer cells
   Plano_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AIY03994
UniProt: A0A0B4R7E3
LinkDB All DBs
Position
30387..31574
Genome map
AA seq 395 aa AA seqDB search
MGKAKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLAKKSGGEARSYAQIDNAPEEKERG
ITINTSHIEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIKGSALKALE
GEAEWEEKIVELMDAVDSYIPTPPRDTEKPFMMPVEDVFSITGRGTVATGRVERGQIKIG
DNVDIIGITEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDVQRGQVLAKPGTI
TPHTEFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVCNLPEGVEMVMPGDNIEM
IVSLISPIALEEGTKFSIREGGRTVGAGVVATITK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagctaaatttgatcgctctaaaacacacgcaaacattggtacaattggtcac
gtcgatcacggtaaaacaactttaactgcagcaatcgctacagttcttgctaaaaaatca
ggtggggaagctcgttcgtacgcacaaatcgacaacgctcctgaagaaaaagaacgtgga
attactatcaacacttcacacattgaatatgaaactgacactcgtcactacgcacacgta
gattgccctggtcacgccgattatgttaaaaacatgatcactggtgctgctcaaatggac
ggcgggatcttagtagtatctgctgctgatggcccaatgccacaaactcgtgagcacatc
cttctttcacgtcaagttggtgttccttacttagtagtattcatgaacaaatgcgacatg
gtagatgacgaagaacttcttgagctagttgaaatggaagtacgcgatcttctatctgaa
tatgacttccctggcgatgacattcctgttatcaaaggttctgctcttaaagctcttgaa
ggagaagctgagtgggaagaaaaaatcgttgaattgatggatgcagttgatagctatatc
ccaactccaccacgtgatactgaaaaacctttcatgatgcctgttgaggatgtattctca
atcactggccgtggaacagttgctacaggacgtgttgagcgtggacaaatcaaaattggt
gacaacgttgatatcattggtatcactgaagagccaaaatctactactgtaactggtgta
gaaatgttccgtaaattacttgactatgctgaagctggcgacaacattggcgcacttctt
cgcggagtttctcgtgatgacgttcaacgtggacaagtattggctaaaccaggcacaatt
actccacatactgaattcaaagctgaagtttacgttctttcaaaagaagagggtggacgt
cacactccattcttcacaaactaccgtccacagttctacttccgtacaactgatgtaact
ggtgtttgtaaccttcctgaaggtgtagaaatggttatgcctggagataacatcgaaatg
atcgtttctctaatctctcctatcgcacttgaagaaggaactaagttctctatccgtgag
ggtggacgtactgtaggcgctggcgttgttgctacaattactaagtaa

DBGET integrated database retrieval system