KEGG   Planococcus sp. PAMC 21323: Plano_1316Help
Entry
Plano_1316        CDS       T03510                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pln  Planococcus sp. PAMC 21323
Brite
Enzymes [BR:pln01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Plano_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIY05281
UniProt: A0A0B4RB98
LinkDB All DBs
Position
1348717..1349325
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYITNVNAALEGHEDLASKSVEELIAD
LDAVPESIRTAVRNNGGGHANHSLFWKLLSPNGGGNPTGALGEAINSKFGSFDEFKEKFA
AAGKTRFGSGWAWLVLSNGELEVVSTPNQDSPLMEGKTPLLGLDVWEHAYYLKYQNKRPD
YINAFWNVVNWEEVSNRYETAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaattaccagaattaccttacgcgtatgacgcacttgaaccacatattgac
aaagaaacgatgaacattcatcacacgaaacaccacaacacgtacatcacaaacgtaaat
gcggctttagaaggtcacgaagatcttgcttcaaaatcagttgaagagttaattgctgat
ctagatgcagttcctgaatctattcgcacagcagttcgcaacaacggcggcggacatgca
aaccattcattattttggaaactattgtctccaaacggtggtggcaacccaacaggcgct
ttaggcgaagcaatcaacagcaagtttggaagctttgacgaatttaaagaaaaattcgca
gctgctggaaaaactcgttttggatcaggatgggcatggcttgttctttcaaatggcgaa
ttagaagtagtatcaacacctaaccaagactctccattaatggaaggtaaaactccgtta
cttggacttgatgtatgggagcatgcttactacttgaaatatcaaaataaacgtccagat
tatattaacgctttctggaacgtagttaattgggaagaagtttcaaaccgttacgaaaca
gcaaaataa

DBGET integrated database retrieval system