KEGG   Planococcus sp. PAMC 21323: Plano_1934Help
Entry
Plano_1934        CDS       T03510                                 

Definition
(GenBank) Serine/threonine-protein kinase prkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pln  Planococcus sp. PAMC 21323
Brite
KEGG Orthology (KO) [BR:pln00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pln01001]
    Plano_1934
Enzymes [BR:pln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Plano_1934
Protein kinases [BR:pln01001]
 Serine/threonine kinases: Other
  Bacterial family
   Plano_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Seadorna_VP7 Pkinase_fungal Haspin_kinase FTA2 YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: AIY05899
UniProt: A0A0B4RCM7
LinkDB All DBs
Position
complement(1950542..1952515)
Genome map
AA seq 657 aa AA seqDB search
MLIGKSINGRYKIKDLIGGGGMSNVYLAHDMILDRDIAIKILRYDFSNEEELRRRFQREA
LSTTSLAHPNIVNIFDVGEDGPIHYLVMEYVPGKTLKDYIIEHSPVSPERAVEIMKQLAS
ALAHAHHNQIVHRDIKPQNILMDNQGNVKISDFGIAMALSATSYTQTNSVLGTVHYLSPE
QARGGMANKKSDIYSLGIVMYELITGKLPFSGESAVSIALKHLQTETPSLLDTVPTLPQS
LENIVLKATAKNIEHRYQSADEMEEDLSTALLPERLNEPKFEVPIDQDETRAMPAIKDSG
AYTSVDDTKTMPLPLNETAKEQNPPVKKKRKKWPWIIGVFSFLLIAGLVQAIAFPGLFEP
RQVEVPDVSGMEHTEAVEELQASGFIVGEETEEFSEEITDNHIIRTIPEAGKMRDREAAI
QLFVSKGKEKVEMNDFVGTMLEDATSELEAKNFASPKSTEEFSEEPVGTILNQRPAAGEE
VVISETEVEFIVSKGEDLRNVEDLAGFTEENLNDYARSSGFNIRIVSEQASSEIEAGKVM
SQTPAAGEQLVAGSTIEVTLSSGVAAQPMKTYIHTVNIPYEPAEPSEEGEEPVEQTIQVY
IQDNTNTMVKPVEEFKITENKSHQIELQIAEGESASYRIVRDSSIILEETFEYSSVE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgttgattggaaaaagcatcaacggccgctataagatcaaggatttgatcggtggtggt
ggaatgtctaatgtttatttggcgcatgatatgattttggatcgggatatcgcaattaaa
attttgcgatatgatttttccaatgaagaagaattacgcaggcgtttccaaagagaagca
ttatccactactagcttggcgcatccgaatatcgtaaatatttttgatgtgggtgaagac
ggtccaatccattatttagtaatggagtatgtaccgggaaaaaccttgaaagattacata
atcgagcattcaccagtctcgcctgagcgagcagttgagattatgaagcagttagcatcg
gctttagcacatgcccatcacaaccaaatcgttcacagagacattaaaccccaaaatatt
ttgatggataaccaaggtaatgtgaaaatatctgattttggtattgcgatggcattaagt
gcgacatcttatacacaaacaaattctgtgttgggaacggttcattatttatcacctgag
caggcacggggcggtatggctaataaaaaatccgatatttactcgcttggaattgtaatg
tacgaattaattacaggtaaactgccgttttctggcgagtcagctgtttcaattgcttta
aaacatttacaaacagaaacgccttctttacttgatacggtcccaacattgccacaaagt
ttagaaaatatcgttttaaaagcaactgcaaaaaacatagaacatcgttatcagtcagct
gatgaaatggaagaagatcttagtacagcattattgccagaacgtctaaatgaacctaag
tttgaagtgcctattgaccaagatgaaacacgtgcaatgcccgctattaaagattctgga
gcttataccagtgtagatgatacgaaaacaatgcctttaccgttgaacgaaacagcaaaa
gagcaaaaccctcctgtgaaaaagaagagaaagaaatggccatggataattggcgtgttc
tcgttcttattaattgcgggactagtgcaagcaatcgcatttcctggactgtttgaaccg
aggcaagtagaagttccagatgtttctggaatggagcatactgaggcggtagaagaatta
caagccagtggttttattgtcggtgaagaaaccgaagagttttcagaagaaatcacagac
aatcatataatacgaaccattccagaagcaggcaagatgagagatcgcgaagcggctatt
caactttttgttagtaaaggaaaagaaaaagttgaaatgaatgattttgttggcaccatg
cttgaagacgcaacaagtgagttagaggccaaaaattttgcttctcctaaatctacagaa
gagttttctgaagaacctgttggaacgattttaaatcagcgaccagctgctggagaagaa
gttgttattagtgaaaccgaagttgagtttattgtcagcaaaggagaagacttgcgcaat
gtcgaggacttggccggatttacggaggaaaacctcaatgattatgcccgttcttcaggt
ttcaatatccggattgtgtctgaacaagcctctagtgaaatagaagctgggaaagtaatg
tctcagacgcctgctgcaggagaacagctagtagcgggtagcacgattgaagtaaccttg
tcttcaggcgtagccgcccaaccaatgaaaacttatattcatacagtcaacattccatat
gaaccagccgaaccgtctgaagaaggtgaagagccagttgaacagactattcaggtttat
atacaagacaataccaatacgatggtaaagcctgtagaggaatttaaaattaccgaaaat
aaatcgcaccagattgaattgcaaattgcagaaggcgaaagtgcatcataccgaattgtt
cgagattcatcaattatcttagaagaaacttttgagtactcaagtgtggaataa

DBGET integrated database retrieval system