KEGG   Planococcus sp. PAMC 21323: Plano_1983Help
Entry
Plano_1983        CDS       T03510                                 

Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pln  Planococcus sp. PAMC 21323
Pathway
pln00061  Fatty acid biosynthesis
pln00620  Pyruvate metabolism
pln00640  Propanoate metabolism
pln01100  Metabolic pathways
pln01110  Biosynthesis of secondary metabolites
pln01120  Microbial metabolism in diverse environments
pln01130  Biosynthesis of antibiotics
pln01200  Carbon metabolism
pln01212  Fatty acid metabolism
Module
pln_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Plano_1983
   00640 Propanoate metabolism
    Plano_1983
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Plano_1983
Enzymes [BR:pln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Plano_1983
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Plano_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK ATP-grasp ATP-grasp_3 ATP-grasp_4 CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AIY05948
UniProt: A0A0B4RCM5
LinkDB All DBs
Position
complement(2002415..2003764)
Genome map
AA seq 449 aa AA seqDB search
MKKILIANRGEIARRIIRTCNRLGIETVAIHSEADGDLPYVSEATEAVLIGPNPVVQSYL
QVEKIIKEAKERGADGIHPGYGLLSENADFARKVAEAGMVFIGPSSDIIEKMGDKIESRK
TMIQAGVPVVPGTEEGVKTLEDALHEAATIGYPLMLKASAGGGGIGMVRCESEQALTQQF
DSVKNRAKAYFGDDVVYLEKFIADARHIEVQIFGDHHGNLVHLYERNCSVQRRNQKVIEE
SPSPNLPEEVREQLCAAALKAGKAVNYTNAGTVEFIVDANNEFYFLEMNTRLQVEHPVTE
EVTGLDLVEWQLNVANGAKLPAQDTIQTHGHAIEYRVYAEDPKTFFPSPGKLEKLQWGEG
ARIETGYEEGNLVTPFYDPMISKIIIHGVNREEALSKSQAFFNDVTINGVKTNISLFKDF
IGSEQFVSGDYATAVLPQWMEKTKEEHTL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcctaattgcgaaccgaggagagattgcacgtagaattattcgcacgtgt
aatcgtcttgggatcgaaacggtagcaattcactctgaggctgatggggatctgccttac
gttagtgaagctactgaagctgtactgatcggtccaaatccggtcgtacagtcttattta
caagttgaaaaaatcataaaagaagcaaaagaacgtggagctgacggaattcaccctggc
tatgggttgctgtctgaaaatgccgattttgctcgtaaagttgcagaagcggggatggtt
tttataggaccttcaagtgatatcattgaaaaaatgggtgacaaaattgagtcgcgtaaa
acgatgatacaagctggagtgccggtagtacccggaactgaagaaggcgttaaaacgcta
gaagatgctttacacgaagcggcgacgatcggttatccgctcatgctaaaagctagtgcg
ggcggcggcggcattggcatggttcgttgtgaaagtgagcaagcgctcactcagcaattt
gactcagtcaaaaatcgtgccaaagcttattttggagacgatgtagtttatctcgaaaaa
ttcattgcagatgcacgtcacatcgaagtccaaatttttggtgatcatcatggcaacctc
gttcatttatatgaacgaaattgttctgttcaacgccgcaaccagaaagtaatcgaagaa
tcaccttcaccaaacttgccggaagaagtgcgtgaacagctttgtgcagctgcacttaag
gctgggaaagctgtgaattatacgaatgcaggaactgtcgaatttatcgtcgatgccaac
aatgaattttatttcttagaaatgaatacacgtttgcaagtcgaacatccggttactgaa
gaagttactggacttgatttggttgaatggcaattaaatgtcgctaatggtgcaaaactt
ccggcacaagatacgattcaaacgcatggacatgcaattgaataccgtgtttatgcggaa
gatcctaaaacctttttcccatcaccaggcaagcttgaaaagcttcaatggggagaagga
gcacgaatcgaaacaggttacgaagaaggtaatttagtcacacctttttatgatccgatg
atttctaaaattattattcacggtgtgaatcgtgaagaagcattgtcgaagtcacaagca
ttttttaatgatgttacaattaatggtgtaaaaaccaatatttctttgtttaaggatttt
attggttcagaacaatttgtttcgggtgactatgctactgcagtgttgccacaatggatg
gaaaaaactaaggaggaacacacattatga

DBGET integrated database retrieval system