KEGG   Planococcus sp. PAMC 21323: Plano_2151Help
Entry
Plano_2151        CDS       T03510                                 

Definition
(GenBank) hypothetical protein
Organism
pln  Planococcus sp. PAMC 21323
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0029 DUF1949 ATP_Ca_trans_C
Motif
Other DBs
NCBI-ProteinID: AIY06116
UniProt: A0A0B4RDS3
LinkDB All DBs
Position
2176323..2176958
Genome map
AA seq 211 aa AA seqDB search
MRENYTTVGDSGSAEILIQKSRFIGHVARAETEQQAIAFIDSIKLLHKTATHNCSAYMIG
EHDSIQKANDDGEPSGTAGFPMLEVLKKQGLKDTVVVVTRYYGGIKLGSGGLIRAYGKAV
SSALSSVGIVDRKMHHLIKTSIDYTWLGKLENEIRQSPFPLDHLEYTEGVDLYIYVPIEK
EKEFIEWINGLTNGQAQIRIVDSQFLEFKLP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagaaaattacacaactgtaggtgattctggcagtgcagaaatacttatccaaaaa
tctaggttcattgggcatgttgcacgggctgaaactgaacagcaagccattgcatttatc
gattctataaaactcctacataaaactgctacccacaattgttcagcttacatgattggc
gagcacgactcaattcaaaaggcaaatgacgacggtgaaccaagtggcactgctggattt
cccatgctcgaagttttaaaaaagcagggattaaaagatactgttgtggttgttacacgt
tattacggtggtatcaaactcggcagtggcggattgataagagcatacggcaaagccgtg
tcttccgcactttcatcagttggaatagttgacagaaagatgcatcatcttataaagact
tctattgactacacatggcttggaaagcttgaaaatgaaattcgccagtcaccctttcca
cttgatcacttagaatacactgaaggggtagacctgtatatttatgtccctattgaaaaa
gaaaaagaatttatcgaatggataaacggattaacaaatggacaggcacagattaggatt
gttgacagtcaattcctcgaatttaaattaccttga

DBGET integrated database retrieval system