KEGG   Planococcus sp. PAMC 21323: Plano_2243Help
Entry
Plano_2243        CDS       T03510                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pln  Planococcus sp. PAMC 21323
Pathway
pln00564  Glycerophospholipid metabolism
pln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Plano_2243
Enzymes [BR:pln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Plano_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored Pyr_redox Tobravirus_2B 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIY06208
UniProt: A0A0B4RDD5
LinkDB All DBs
Position
complement(2274185..2275861)
Genome map
AA seq 558 aa AA seqDB search
MKFSSLNRNERYNQMKQNQLDVLVIGGGITGAGIALDATVRGMNIAVVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKEREIVYENGPHVTTPEWMLLPFYKGGTFGPLSTNV
GLRVYDFLAGVKKSERRKMLSKEETLRREPLLKKKGIKGGGYYVEYKTDDARLTMEVMKK
AIEKGAMAMNYAKVKSFIYDNGKAVGVRVEDQIDGTIHELFAKKIVNAAGPWVDTLRDKD
HSKFGKTLQLTKGIHLVFDGRRFPMKQAIYFDMPDGRMAFAIPRQGKVYVGTTDTVYKQD
IAHPTMTEEDRDYVLKAVDFMFPEVGITKEDVESSWAGLRPLIHEEGKDPSEISRKDEIF
ISDSGLISIAGGKLTGYRKMGESIINIVAEQLQKEGGKKYPKSSTKRLPISGGEVGGSKG
FKTFREDRVRQASGMGLTADAMNMLVSRYGANVDTVLHFYTKGIDEAAEAGLDPIVYAML
RYSMEYESAYKPIDFFIRRTGALFFDIHWVHAHKESVIAYMSKTLVWSEEQTEEYRTELE
GLLYEATHPVKISSLSSN
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtttaaacagaaacgaacgttataaccaaatgaaacaaaatcaattg
gacgttttagtaattggtggaggcattacaggtgctggtattgcattagacgctacggtt
cgcggtatgaacatcgcggtagtcgaaatgcaagatttcgcagcaggtacaagtagccgt
tcaacgaaactggttcacggtggcttgcgttacttaaagcaatttgaagtgaaaatggtt
gcagaagtaggaaaagaacgtgaaatcgtttatgaaaatggaccgcatgtaacaactcct
gaatggatgctattaccgttttacaaaggtgggacattcggaccgctcagcacaaacgtt
ggtttgcgcgtctatgactttttagcaggcgttaaaaaatcagaacgtcggaaaatgtta
agcaaagaagaaacattgcgccgtgagcctttattgaagaaaaaaggcattaaaggtggc
ggttattacgttgagtacaaaacggatgatgcgcgtttaacaatggaagttatgaaaaaa
gcaatcgaaaaaggcgctatggcaatgaactacgcaaaagtgaaaagctttatatatgat
aatggcaaagcagtgggtgttcgtgtagaagatcaaatcgatggcacaatccacgaacta
tttgcgaagaaaattgttaacgcggctggaccatgggtagatacattgcgtgataaagac
cattcgaaattcggtaaaactttgcagttaacaaaagggattcacttggtttttgatggc
cgtcgtttcccgatgaaacaagcaatttattttgatatgccagatggtcgaatggcgttt
gctataccgcgtcaaggaaaagtgtatgttgggactacagatacggtatacaaacaagat
atcgcacatccaacgatgacagaagaagatcgtgattatgtgttaaaagcggttgacttt
atgttcccagaagtaggcattactaaagaagatgttgaatcaagctgggctggcttgcgt
ccgttaatccatgaagaaggaaaagacccttctgaaatttcacgtaaagacgaaattttc
atttccgattcaggattgatttcaattgcgggtggtaaattgacaggttaccgtaaaatg
ggcgaaagcattatcaacatagtagccgagcaactgcaaaaagaaggcggcaaaaaatat
ccgaagagctcaacaaaacgcttaccaatttcaggtggtgaagtaggcggttcgaaaggc
tttaaaacgtttagagaagaccgtgttcgacaagcaagtggtatggggctaacagctgac
gcgatgaatatgctggtaagtcgctatggtgctaatgttgacacagttctccatttctat
acaaaaggaatagacgaagcagcagaagctggacttgatccaatcgtttacgcgatgttg
cgttattcaatggaatacgaatcagcatacaaaccaatcgacttctttatccgtcgtacg
ggtgcgttgttctttgatattcactgggtacatgcacataaggaaagtgtcattgcttat
atgagcaaaacgcttgtgtggagcgaagaacaaacagaagaataccgcactgaactagaa
ggtttgctttatgaagcaacgcatccagttaaaatatcttcactaagctcaaactaa

DBGET integrated database retrieval system