KEGG   Planococcus sp. PAMC 21323: Plano_2965Help
Entry
Plano_2965        CDS       T03510                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pln  Planococcus sp. PAMC 21323
Brite
KEGG Orthology (KO) [BR:pln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Plano_2965
Enzymes [BR:pln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Plano_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 NAD_binding_7 Thioredoxin_4 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AIY06930
UniProt: A0A0B4RG62
LinkDB All DBs
Position
3041420..3042967
Genome map
AA seq 515 aa AA seqDB search
MILDKAIKAQLEQYLQLLENDVLLKVSAGTDKFSRDMTALVEEISAMSSRITVEHTELER
TPSFSVNRPGQDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVDQHVIDQIQSIEGSYHF
DSYISLSCQNCPEVVQALNLMSILNQNITHTMIDGAVYKEEVERKDIMAVPTVFLNGESF
ASGRMTLEELLAKLGSAPDASEFANKEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLSIENFISVKKTDGPKFAASLEEHVKEYDIDVMNLQRAKKLEKKEFFELELE
NGAVVKGKTIILSTGARWRNVGVPGEEEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGV
EAAIDLAGLVNHVTVLEYNSELKADSVLQDRLRSLPNATVITNARTQEITGTDKVNGISY
LDLQTGNVNHIELAGVFVQIGLVPNTDWLGDFVERTQHGEIVIDQRGATNVSGVFGAGDC
TNIPYKQIIISMGSGATASLSAFDHLIRSEVPVLV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatattagataaagcaataaaagcgcaattagaacagtatctacaattgctggaaaac
gatgtgttgttaaaagtcagcgctggaactgataagttttctcgcgatatgacagcattg
gtcgaagagatatctgctatgtcttcccgcattactgtagagcatacagagctagaacga
acaccaagctttagcgtcaatcgccctggacaagatacaggggttgtatttgccggtatt
cctttggggcatgagttcacgtctcttgttctagcattattgcaagtgagtggacgtgca
ccgaaagtcgatcaacacgtaattgatcaaattcaaagcattgaaggttcataccatttc
gactcttacatcagcttgagctgtcaaaactgtccggaagtggttcaagcgctcaacttg
atgagtatactcaaccaaaacatcacacataccatgatcgacggagcagtatacaaagaa
gaagttgaacgtaaagacatcatggctgtaccaaccgttttcttaaacggtgaatcgttc
gcaagtggacgtatgacacttgaagaattgctcgctaaacttggcagcgctccagatgct
tctgaatttgccaacaaagaaccgtttgacgtacttgttgtcggtggcggaccggctgga
gccagcgctgcgatttacgcagcacgcaaaggaatccgtactggtattgttgctgagcgt
tttggcggtcaagtaatggatacgttgagcatcgagaacttcattagtgtcaaaaagaca
gatggcccgaaatttgcggctagtcttgaagagcatgtgaaagaatacgatattgacgtg
atgaacttacaacgtgcgaaaaagttggagaaaaaagaatttttcgagcttgaacttgaa
aatggggctgttgtaaaaggcaaaaccatcattctttcaactggtgcacgctggcgtaat
gttggcgttccaggtgaagaagaattcaagaacaaaggtgttgcttactgtccacattgt
gatggtccattgtttgcgggcaaagacgtagcggttatcggcggtggaaactctggcgtt
gaagcagcaattgatttggcaggtcttgtgaatcacgtaactgttttggagtacaactct
gagcttaaagccgattcagttttacaagatcgtctacgcagcttaccaaacgcaacggtt
atcacaaacgctcgcacacaagaaattaccggaacagataaagtaaacggcatttcttat
cttgatctgcaaaccgggaatgtgaaccacatcgaattagctggcgtgtttgttcaaatt
ggtctggtaccgaatacagattggctaggagactttgttgaacgcacacagcatggtgaa
atcgtcattgaccagcgtggcgcgactaacgtttcaggtgtttttggagctggagactgt
actaacatcccttataaacaaatcatcatttcaatgggatctggtgcgactgcctcattg
agtgctttcgaccatcttattagaagtgaagttcctgttttggtttaa

DBGET integrated database retrieval system