KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0314Help
Entry
Ple7327_0314      CDS       T02367                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00630  Glyoxylate and dicarboxylate metabolism
plp00710  Carbon fixation in photosynthetic organisms
plp01100  Metabolic pathways
plp01120  Microbial metabolism in diverse environments
plp01200  Carbon metabolism
Module
plp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
plp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
plp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:plp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ple7327_0314
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ple7327_0314
Enzymes [BR:plp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ple7327_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY75779
UniProt: K9T194
LinkDB All DBs
Position
359384..359719
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPMTDQQIAKQIQYMLDQGYIPAVEFEENPQPSDHHWTLWKLPL
FSATSPQEVLNEVRECRAEYSNCYIRVIGFDNIKQCQTMSFIVHKPNSSRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacccaaagagcgccgttacgaaactctctcctatttgcctcccatgacg
gatcagcaaattgccaagcagatccagtacatgttagaccagggatatattcctgcggtt
gagtttgaagaaaatccccaacctagcgatcaccactggactttgtggaagttgccgcta
tttagtgcgacttctccccaagaagttcttaatgaagtgcgcgaatgccgtgctgagtat
tccaactgctacattcgcgtcattggctttgacaacattaagcagtgccaaacgatgagc
tttatcgttcacaagcctaattccagccgttactaa

DBGET integrated database retrieval system