KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1530Help
Entry
Ple7327_1530      CDS       T02367                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Brite
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ple7327_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFY76906
UniProt: K9T440
LinkDB All DBs
Position
complement(1624022..1624624)
Genome map
AA seq 200 aa AA seqDB search
MAYELPALPYDYTALEPVISKKTLEFHHDKHHAAYVNNYNSAVKGTEFENKSIEEVIKAV
AGDSSKTAIFNNGAQAWNHTFYWNCMKPNGGGTPSGALADKIKADFGSFDKFVEEFKTAG
ATQFGSGWAWLVLDNGTLKVTKTPNADNPIVAGQVPLLTMDVWEHAYYLDYQNRRPDYIN
EFISKLINWDFVAQNFAAAS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaacttcctgcactaccatacgactacacggcactagaaccagttatttct
aaaaaaacccttgaatttcatcacgataagcaccatgctgcctatgtaaacaactacaat
tcggcagtaaagggaaccgaattcgagaacaagtcaattgaagaagtcatcaaagcagtt
gcaggcgattcttctaaaactgcaatcttcaacaatggtgcccaagcttggaaccacact
ttttattggaattgtatgaaacccaacggcggcggcactcccagtggggcactggcagac
aaaattaaggctgactttggcagtttcgataaatttgtcgaggaattcaagacagcaggc
gctacccagttcggtagcggttgggcttggttagtacttgacaacggtacgctgaaagtc
accaaaactcctaatgccgataatccaatcgtagccggacaagttcccctactcactatg
gatgtgtgggaacacgcctattatctggactaccaaaatcgtcgtcccgactacatcaat
gagttcatcagcaaattaattaactgggatttcgtcgctcaaaatttcgcagcggctagc
tag

DBGET integrated database retrieval system