KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4407Help
Entry
Ple7327_4407      CDS       T02367                                 

Definition
(GenBank) exoribonuclease R
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Brite
KEGG Orthology (KO) [BR:plp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plp03016]
    Ple7327_4407
Enzymes [BR:plp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Ple7327_4407
Transfer RNA biogenesis [BR:plp03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    Ple7327_4407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: AFY79515
UniProt: K9TAE8
LinkDB All DBs
Position
complement(4719007..4721007)
Genome map
AA seq 666 aa AA seqDB search
MEKGKLIEFRRQGERRLAVTDRPEGKKDWIVLDEGGVAHKIRPQQVEYEIDGGSYKPSDI
PSFIQQVKPYLDPSSLEVAWELLVEEGKAVSPSEMAQLLFSDQSPLLCYAAHCLLSEDKI
YFKRKGDLYEPRSASQVDEIKHQIEVERQRHREKEAFLDRLQQALAGERVEWAESDRSRL
EAIEKFVLQPEQPARAAQEILSWAGRSQTPEAAFELLVDLGWWSPHENLFLRRSGYPLQF
PKKVLEVAQSCLISPPSDPDPNRLDLTHLKVYTIDDESTEEIDDGLSVEFLKHGKVRLWI
HIADPSRLVTPGDELDLEARRRSTSLYLPTGMISMFPTVLATDPMSLVQGKLCPALSFGV
VLDETGTVEDYSIYTSLIKPTYRLTYEDVDEMLELGIQAEPEIAALATWAQRRQQWRRSQ
GSIDIQMPESVIKVKADDEIVIELLEVSRARQLVAEMMILAGEVAGRYCQEHNLPVPFRG
QPQPELPPEEELLLLPAGPVRACALRRCMPRSEIGITPIRHASLGLDTYTQVTSPIRRYT
DLLAHFQLKAHLRGDSLPFSREQMQEILYSVTSSAQEATAVERQTNRYWGLEYLRRHADC
VWQVLVLRWLREEENLGIILLEELGLELPHRFERPVSLGDRLKVQVYRADPHRDEIRFRE
AIGQVS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagggaaagctgattgaattcaggcggcaaggagaacgccgtctcgccgttaca
gaccgtccagaaggcaaaaaagattggatagttcttgatgaagggggagttgctcataaa
attcgccctcaacaggttgaatacgaaattgatggcggctcctacaagccttctgatatt
cctagcttcattcaacaggtaaaaccctacctagacccttcgagtttagaagttgcttgg
gaacttttggtagaagagggaaaggcggtttctccttcggaaatggcacagctactattt
tctgaccaaagtccgcttttgtgctatgccgctcattgcttgctatcggaagataaaatc
tatttcaagcgaaaaggcgatctctacgaaccccgttcggcaagccaggttgatgaaatt
aagcaccagatagaagtagagcggcagcgccatcgagaaaaagaagcatttttagaccgc
ttacaacaagcattagcaggggaaagagtagaatgggcagaaagcgatcgctctcgttta
gaagcgatcgaaaaattcgtcttacagccagagcaacccgcacgtgcggctcaagaaatt
ttaagttgggcagggcgatcgcaaacgccagaagcagcgtttgaattgttggtagatcta
ggctggtggagtccccacgaaaacctattcctccgccgtagcggataccctttgcagttt
cctaaaaaggttcttgaagtggcgcaaagttgcctgatatctcccccgtccgatcccgac
cccaatcgtttggatttaacccatctaaaggtttacaccattgacgatgaaagtactgaa
gaaattgatgatggtttgagcgtcgaatttcttaagcatggaaaagtgcgcctatggatt
catattgccgatcccagtcgattagttacccctggagacgaactcgatctagaagcaaga
cggcgcagtactagcttgtatttgcctacgggtatgatttccatgtttccgaccgtactg
gcaaccgatccgatgagtttagtgcaaggaaaactctgtcccgctttgagttttggcgta
gttttagacgagacggggacggtagaagattacagcatttacactagcctgattaaaccc
acctatcgccttacctatgaagatgttgacgagatgctcgaactcggcattcaagccgaa
ccagagattgctgccttagcaacttgggcacaaagacggcaacaatggcggcgatcgcaa
gggtcgatcgatattcaaatgcccgaatccgtcatcaaagtcaaagctgacgacgagatt
gtcatcgaattgcttgaggtttcgcgtgcccgccagctagtagccgaaatgatgattttg
gcaggagaagtagcaggacggtactgccaggagcataacttacccgttccttttcgagga
caaccccaaccagaattacccccagaagaagaacttttactcctgcctgcggggccggtg
agagcctgtgccctgcgtcggtgcatgcctcgcagcgagatcggcattacacccattcgt
catgccagtttgggtttggatacctacacgcaagtaacttcgcctattcgtcgttacacc
gatttgttggctcattttcaactgaaagcccatttgcgcggcgatagtttgcctttttct
cgcgaacagatgcaagagattctctacagcgttacctcctcagcgcaagaggcaaccgct
gtcgaacgacagacaaaccgctattggggcttagaatatttgcgtcgccatgccgattgc
gtttggcaagtgttggtcttgcggtggctgagggaagaagaaaacttaggcataatttta
ttagaggaattgggattagagttaccccatcggttcgagcgccccgtttccctaggcgat
cgcctgaaagtccaagtctatcgcgccgacccccatcgcgatgagatccgctttcgagaa
gcgatcggtcaagtttcgtaa

DBGET integrated database retrieval system