KEGG   Pseudomonas lundensis: AA042_00780Help
Entry
AA042_00780       CDS       T05473                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
plq  Pseudomonas lundensis
Pathway
plq00500  Starch and sucrose metabolism
plq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AA042_00780
Enzymes [BR:plq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AA042_00780
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AA042_00780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AOZ11358
UniProt: A0A1D9IH27
LinkDB All DBs
Position
complement(170170..173517)
Genome map
AA seq 1115 aa AA seqDB search
MAKNVATASFINDPLWHKDAVIYQVHVKSFFDSNNDGIGDFPGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIADYRGVHPDYGTLADVKRFIAEAHKRGLRVITELVINHTSDQHP
WFQKARHAKPGSKARDYYVWSDTDEKYDGTRIIFLDTESSNWTWDPVAGQYYWHRFYSHQ
PDLNFDNPQVMKEVLAVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHQILKQIRA
EIDAHYPDRMLLAEANQWPEDTQQYFGDTDGINGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRANPASLVLPPIMDPLYGYQSVNVEAQSGDPHSLLNWTRRLLAVRKQQQAFGRGSLKM
LSPSNRRVLAYIREYTDSQGKNETILCVANVSRSAQAVELDLSEYGGRVPVEMLGGNAFP
PIGQLHFMLTLAPYGFYWFLLAPESQMPGWHAEPVQSLPELVTLVIKKRIEEVLEAPTRT
TLERVTLPAWLPKQRWYGQKGAPIEHVEWVYGTRLGQADTPMLLTEVRVTAGGQPRRYQL
PLGVVGEDQPVSALAQQLVLCRARRVRQVGFITDAFSLEPFVRTVLSHLHAGTVLDSDAG
QIRFTPTAQWAKQGLDENSEIRYLSAEQSNSSVVVGGTLVLKLIRQLSTGVHPELEMGAY
LTAAGYPNISPLLGAVERHDADGESTLLMIAQGYLSNQGDAWTWTQNNLERAIRDELADA
MSEHDQHYNALGELADFAAVLGRRLGEMHQVLASATDNPDFTPQTTGAKEARHWATAISR
QVHAALQQLDAHLSQLSAEDQAQVKHWLKHEREIGAYITSLADHTLGGPLIRVHGDLHLG
QVLVVQGDAYFIDFEGEPARPLQERRSRHSPYKDLSGLLRSFDYAAAMAVAQVQQADHSP
EADLARQRVVERYLEQARGALTQAYSHATANLASGWKVEGGPQAALTLFSLEKAAYEVIY
EAANRPAWLQVPLRGLSALLSQVPGMSKPLNGEKQ
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaacgtcgcaaccgcaagttttatcaacgacccgctctggcacaaggacgcg
gtgatttatcaagtgcacgtgaaatcgtttttcgactccaacaatgacggaatcggcgat
tttccgggcctgatcagcaaactcgattacattgcggagctgggggtcaacaccctgtgg
ctgctgccgttctacccatcgccacggcgtgacgatggctacgacatcgccgattatcgc
ggcgtccacccggattacggcaccctggccgatgtgaagcgtttcatcgctgaagcccac
aagcgtgggctgcgggtcattaccgagctggtgatcaaccacacctctgaccaacacccc
tggtttcaaaaggcgcggcacgccaaacccggctccaaggcccgggattattacgtgtgg
tccgacaccgacgaaaagtacgacggcacgcgcatcatctttctcgacaccgaaagctca
aactggacgtgggacccggtcgcgggccaatactattggcaccgtttctactcccaccaa
cccgaccttaacttcgacaacccgcaggtcatgaaagaagtgctggcggtgatgcgctac
tggctggacatgggcatcgatggcctgcgcctggatgccattccgtacttgatcgagcgc
gacggcaccaacaatgaaaacctgcccgaaacccatcagattctgaaacagatccgcgcc
gaaattgatgcgcactacccggatcgcatgctgctggccgaggccaaccaatggcccgag
gacacccagcagtacttcggtgacaccgacggcatcaatggcgacgaatgccacatggcg
ttccatttccccttgatgccgcgcatgtacatggcgctggcgcaggaagaccgctttccg
atcaccgacatcctgcgccagaccccggaaatccccgccaattgccagtgggcgatcttt
ttgcgcaaccacgatgagctgacgctcgaaatggtcaccgacaaagaacgcgattacctg
tggaattactacgctgcggaccgtcgtgcgcggatcaacctgggcatcaggcggcgcctg
gcacccttgatggaacgcgaccgtcggcgcattgagctgctcaacagcctgttgctgtcc
atgcccggcacgcccaccttgtattacggcgatgaaatcggtatgggcgacaacatctat
ctgggcgaccgcgacggcgtgcgcacccccatgcagtggtcgattgaccgcaatggcggg
ttttcgcgcgccaacccggccagcctggtgctgccgccgatcatggacccgttgtacggc
tatcaatccgtcaacgtcgaggcccagtccggcgacccgcactcgttgctcaactggact
cgccggttgctggccgtgcgcaagcaacagcaagccttcggccgcggcagcctgaaaatg
ctgtcaccgagcaaccgcagggtgctggcctacattcgcgaatacaccgacagccagggt
aagaacgaaaccatcctctgcgtggccaacgtgtcacgcagcgcccaggcggttgagctg
gacctcagcgagtacggcggccgagtgccggtggaaatgctcggtggtaatgcgttcccg
ccgattggccagttgcacttcatgctgacgctggcgccatatggcttctattggttcctg
ctggcgccggaaagccaaatgccgggctggcacgccgagccggtacaaagcctgccggag
ctggtcacgctggtgatcaaaaaacgcattgaagaagtgctcgaagcgccgacccgcacc
actctggagcgcgtcaccctgcctgcctggctgcccaagcagcgctggtacgggcaaaaa
ggcgcgcctatcgagcacgtggagtgggtgtacggcacacgcctggggcaggccgacacg
ccgatgttgctgaccgaagtgcgggtgaccgcgggcggtcagccgcgtcgttaccaactg
ccgctcggggtcgtgggtgaagatcagcccgtcagcgccctggctcagcaattggtcctg
tgccgcgcccgacgggtgcgtcaggtcgggttcattaccgatgcgttcagccttgaaccg
tttgtgcgcacggtgttgagccacctacacgccggtacggtgctggacagcgacgcaggt
cagatccggttcaccccgaccgcgcagtgggctaaacagggtctggatgaaaacagcgag
attcgttacctgtcggccgagcagtccaacagctcggtggtggtcggcggcaccctggtg
ctcaaactcattcgtcagctcagcaccggcgtgcacccggagctggaaatgggcgcttac
ctcacggcggcgggctacccgaatatttctccgttgctcggtgccgtggagcgccatgac
gccgacggcgaaagcaccttgctgatgatcgcccaaggctatctgagcaatcagggcgat
gcgtggacctggacccaaaacaatctggagcgcgccatacgtgacgaactggcggatgcc
atgtccgaacacgatcagcactacaacgccctgggcgagctggccgactttgcggccgtg
ctgggccgccggctgggcgaaatgcatcaggtgctggccagcgcgaccgacaacccggat
ttcacgccgcagaccaccggcgcgaaagaggcacgccattgggccacggccatcagtcgg
caggtccacgcggcgttgcagcaactcgacgctcacctgtcgcagttgtccgccgaggat
caggcgcaggtcaagcactggctcaaacatgagcgcgagatcggcgcttacatcacctcc
ttggccgatcacaccctcggcggtcccctgattcgcgtgcatggcgacttgcacttgggg
caggtgctggtggtgcagggcgatgcgtatttcatcgactttgaaggtgaaccggcgcgg
cccttgcaagaaagacgcagccgtcacagcccgtacaaagacctcagcgggctgctgcgt
tcgttcgactacgccgccgccatggcggtggcacaggtgcaacaggcggaccattcgccc
gaggccgacttagcccgccagcgcgtggtcgagcgttaccttgagcaagcgcgcggtgcc
ttgacgcaggcgtattcccacgcaacagctaatctggcttcaggctggaaggtggagggt
ggcccgcaggctgcactgaccctcttcagcctggaaaaggcggcctatgaagtgatctat
gaagcggccaaccggcctgcctggctacaggttccactgcgcgggctgagcgccttgctc
agtcaggtgccaggcatgtccaagcctttgaacggagagaaacaatga

DBGET integrated database retrieval system