KEGG   Pseudomonas lundensis: AA042_02295Help
Entry
AA042_02295       CDS       T05473                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
plq  Pseudomonas lundensis
Pathway
plq00020  Citrate cycle (TCA cycle)
plq00190  Oxidative phosphorylation
plq00650  Butanoate metabolism
plq01100  Metabolic pathways
plq01110  Biosynthesis of secondary metabolites
plq01120  Microbial metabolism in diverse environments
plq01130  Biosynthesis of antibiotics
plq01200  Carbon metabolism
Module
plq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
plq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AA042_02295
   00650 Butanoate metabolism
    AA042_02295
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AA042_02295
Enzymes [BR:plq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AA042_02295
    1.3.5.4  fumarate reductase (quinol)
     AA042_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AOZ11610
UniProt: A0A2C8EV09
LinkDB All DBs
Position
complement(536082..536786)
Genome map
AA seq 234 aa AA seqDB search
MLKVSVYRYNPDQDAAPFMQEFQVNTNGKDLMVLDVLALIKEQDEGFSYRRSCREGVCGS
DGMNINGKNGLACVTPLSAVVKGNKLVIRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTSERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRSMLLQSGV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcagtgtttatcgctacaacccggatcaggacgctgcaccgttcatgcaa
gagttccaggtcaataccaacggtaaagacctgatggtgctggacgttctggccctgatc
aaagagcaggacgaaggtttttcctatcgtcgctcttgccgcgaaggcgtgtgtggctcc
gacggcatgaacatcaacggcaagaacggcctggcgtgcgtaacgccgctgtccgctgtc
gtaaaaggtaacaagctggtgatccgtccgctgccaggtttgccggttatccgtgacctg
gtcgtcgacatgagcatcttctacaagcaatacgagaaggtgaagccgttcctgcagaac
gatacgccggccccggccatcgaacgtctgcaatcgccagaagagcgtgaaaagctcgac
ggtctgtacgagtgcatcctgtgcgcttgctgctcgacttcgtgcccgtccttctggtgg
aacccggacaagttcctgggccctgctgcactgctgcaagcctaccgtttcctggctgac
agccgtgacaccaagaccagcgagcgtctggcttcactggatgacccgttcagcgtattc
cgctgccgcgggatcatgaactgcgtgaacgtgtgtccgaagggtctgaacccgactaag
gccatcggccacgtgcgtagcatgctgctgcaaagcggcgtctga

DBGET integrated database retrieval system