KEGG   Pseudomonas lundensis: AA042_05615Help
Entry
AA042_05615       CDS       T05473                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
plq  Pseudomonas lundensis
Pathway
plq00473  D-Alanine metabolism
plq00550  Peptidoglycan biosynthesis
plq01100  Metabolic pathways
plq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA042_05615
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA042_05615
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AA042_05615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:plq01011]
    AA042_05615
Enzymes [BR:plq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AA042_05615
Peptidoglycan biosynthesis and degradation proteins [BR:plq01011]
 Precursor biosynthesis
  Amino acid ligase
   AA042_05615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp RimK GARS_A TTL ATPgrasp_YheCD ATP-grasp_5 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AOZ12197
UniProt: A0A1D9IJD0
LinkDB All DBs
Position
complement(1284660..1285616)
Genome map
AA seq 318 aa AA seqDB search
MTAAYANLFSTIAPADFGRVAVLFGGKSAEREVSLKSGNAVLNALQSAGVDAFGIDVGDD
FITRITHEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLSTEADCISAAKELCFPLIVKPAHEGSSIGMAKVNSVDELISAWADASK
YDSQVLVEQWISGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYVANDTQYRVPCGLDSA
KEQELMDLTAKACEAIGIAGWGRLDVMQDADGQFWLLEVNTAPGMTDHSLVPMAAKAAGL
DFQQLVLSILAASVERRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcctacgccaacctgttttcgaccattgcccccgcagacttcggccgcgta
gcggtgctgttcggcggtaaaagcgctgagcgtgaagtgtcgctcaagtctggcaatgcg
gtcttgaatgcgctgcaaagcgccggcgtggatgcgttcggcattgacgtgggcgatgac
ttcatcacccgtatcacccacgaaaaaattgaccgtgcgttcatcattctgcatggtcgt
ggcggtgaagacggcagcatgcagggcctgctggaatgccttggcattccttacaccggc
agcggcatcctggcgtcagccttggcaatggacaagttgcgcaccaaacaggtgtggcac
agcctgggtattccgaccccgcgccatgccgtattgagcactgaagccgattgtatttct
gcggcgaaggaactgtgcttccctttgatcgtcaaaccggcccatgaaggttcaagtatc
ggtatggccaaagtgaacagcgttgacgagttgatcagcgcatgggccgacgccagcaag
tacgattcgcaagtgttggtcgaacaatggatctcgggtcctgagttcaccatcgccacc
ctgcgtgaccaggtgttgcctccgattgccctgggcaccccgcatacgttctacgactac
gacgccaaatacgtggccaacgatacccagtatcgcgtgccatgcggtctcgatagcgcc
aaggagcaagagctcatggacctcacggcaaaagcctgtgaggcgatcggtatcgccggt
tggggccgtctggatgtcatgcaggacgccgatggccagttctggctgctggaagtcaac
accgcgccgggcatgaccgatcacagcctggtgccgatggcggccaaggctgccggtctc
gattttcaacagttggtgctgtcgattctggcagccagtgtagagcggcgaggttaa

DBGET integrated database retrieval system