KEGG   Pseudomonas lundensis: AA042_06195Help
Entry
AA042_06195       CDS       T05473                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
plq  Pseudomonas lundensis
Pathway
plq00250  Alanine, aspartate and glutamate metabolism
plq00410  beta-Alanine metabolism
plq00430  Taurine and hypotaurine metabolism
plq00650  Butanoate metabolism
plq01100  Metabolic pathways
plq01110  Biosynthesis of secondary metabolites
plq01120  Microbial metabolism in diverse environments
plq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AA042_06195
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA042_06195
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA042_06195
   00430 Taurine and hypotaurine metabolism
    AA042_06195
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AA042_06195
Enzymes [BR:plq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AA042_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 dCache_3
Motif
Other DBs
NCBI-ProteinID: AOZ12295
UniProt: A0A1D9IJT2
LinkDB All DBs
Position
complement(1403688..1405085)
Genome map
AA seq 465 aa AA seqDB search
MALHRTKRHSDTDPVFGSSALAHAAATKLFPEAEQSAREVYQLVHDELYLDGNARQNLAT
FCQTWEEDEVHKLMDLSIDKNMIDKDEYPQSAELENRCIHMLADLWHSPSAATTIGTSTV
GSSEACMLGGLAALWRWRAARKAAGKQTTTPNMVCGPVQVCWHKFARYWDIEIREVPMSD
GQWFMTPEDMLERIDENTIVVVPTFGQTFTGLYETVKPLSDALDDLEKRNGLNVAIHVDG
ASGAMLAPFCAPDIEWDFRLSRVKSISTSGHKFGLAPLGAGWVVWRDVQDLPEGLIFHVN
YLGGDMPTFALNFSRPAGQIIAQYYNFLRLGREGYERIHSACYETAQFLARELVKIGPFE
MLYNGDPQLGIPALTWRLKPGVKTNFSLYDLADRLRVRGWLVPAYSLPANVENVVVQRIL
VRQGLSIDMAKLLLADFERDIKFFDEHQPHGFKGREAEAGNHAGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaccgcaccaaacgtcatagcgacacggatcccgtttttggttcatcggca
ttggcgcatgccgcggcaaccaaactgttccccgaagccgagcagtctgcgcgcgaggtt
taccagctggtccatgatgagctgtatctggacggcaacgcccgccagaaccttgcgact
ttctgccagacctgggaggaggatgaagttcacaagctcatggacctgtccatcgacaag
aacatgatcgacaaggacgaatacccacaatcggctgaactcgaaaatcgctgcattcat
atgctggcggatctttggcattcacccagcgcagcgaccaccatcggcacctccacagtc
ggctccagtgaagcctgcatgctgggcggtctggctgcattgtggcgttggcgagcggcc
cgcaaagcagcgggcaaacagaccaccaccccgaacatggtgtgcggcccggtacaagtc
tgttggcacaaatttgcgcgttattgggacattgaaatccgtgaagtgcccatgtcagac
gggcaatggttcatgacccccgaggacatgcttgagcgcattgatgaaaacaccatcgtg
gtggtgccgacgtttggtcagacgtttaccggcctgtatgaaaccgtgaagccgctctcc
gatgcactggatgatctggaaaaacgcaatggcctgaatgtggcgattcatgtcgacggc
gccagcggcgccatgttggctccattttgtgcgccggatattgagtgggatttccgtttg
tcgcgagtcaaatccatcagcacttccgggcataaattcggcctggcgcctttgggggcg
ggctgggtagtgtggcgagacgtgcaggacctgccggaaggtctgatattccacgtcaac
tatttggggggcgatatgccgacgtttgccctcaatttttcacgcccggccgggcagatc
atcgcgcagtactacaactttttgcggttgggccgagaagggtatgagcgcattcattcg
gcgtgttacgaaacggcgcaatttctggcccgtgaactggtgaagatcgggccgtttgaa
atgctgtacaacggcgatccacaactgggcatcccggcgctgacctggcgtttaaagccc
ggcgtgaaaaccaacttctcgctttacgatctggcagatcgattgcgggtaaggggctgg
ctggtcccggcctatagcctgccggccaatgttgaaaacgtcgtagtgcaacggattctg
gtacgtcaggggctgtcgatcgacatggccaaactgttgttggcggactttgagcgggac
atcaagttttttgatgagcatcagccccacgggttcaaaggccgtgaagccgaggcgggt
aatcacgcaggacgctga

DBGET integrated database retrieval system