KEGG   Pseudomonas lundensis: AA042_10795Help
Entry
AA042_10795       CDS       T05473                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
plq  Pseudomonas lundensis
Pathway
plq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:plq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AA042_10795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plq02000]
    AA042_10795
Enzymes [BR:plq01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AA042_10795
Transporters [BR:plq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AA042_10795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_29 AAA_16 AAA_15 AAA_25 Rad17 AAA_23 AAA_33 Adeno_IVa2 TniB AAA_28 AAA_30 NACHT
Motif
Other DBs
NCBI-ProteinID: AOZ13093
UniProt: A0A1D9IM60
LinkDB All DBs
Position
2377841..2378674
Genome map
AA seq 277 aa AA seqDB search
MQHESTSHGINMSALGRTKQSLNLANEEVAIEVPGLNLYYGEKQALFDVSLNIPKQRVTA
FIGPSGCGKSTLLRTFNRMNDLVDGCRVEGEINLYGHNIYRKGEDVAELRRRVGMVFQKP
NPFPKTIYENVVYGLRIQGINKKRILDEAVEWALKGAALWDEVKDRLHDSALGLSGGQQQ
RLVIARTIAVEPEVLLLDEPCSALDPISTLKVEELIYELKSKFTIVIVTHNMQQAARVSD
YTAFMYMGKMVEYGDTDTLFTNPAKKQTEDYITGRYG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatgaatccacgtcccacggcatcaacatgtccgccttgggtcgcaccaaacaa
agcttgaacctggccaatgaagaagttgccattgaagtcccggggctgaatctttattac
ggcgaaaagcaggcgctgttcgacgtgagcctgaacattccgaaacaacgcgtgactgcg
ttcatcgggccgtcgggttgcggcaagtccaccctgctgcgtacgttcaaccgcatgaac
gatttggtagacggctgccgcgttgaaggtgaaatcaacctttacggtcataacatctac
cgcaagggcgaagacgttgccgagctgcgtcgccgcgtgggcatggtgttccagaagcct
aacccgttccccaaaaccatctacgaaaacgtggtttacggcctgcgcattcagggcatc
aacaaaaaacgcatcctcgacgaagccgtggagtgggccctcaaaggcgcggcgttgtgg
gatgaggttaaagaccgtttgcacgactcggcactcggcttgtccggtggtcagcagcag
cgtctggtgattgcccgtaccatcgcggtcgaacctgaagtattgctgctcgatgagccg
tgctcggcacttgacccgatctcgacgctgaaggttgaggagctgatttacgagctcaag
tccaagttcaccatcgtgatcgtgacccacaacatgcagcaggcggcgcgggtgtcggat
tacaccgccttcatgtacatgggcaagatggttgaatacggcgacaccgacacgctgttc
accaacccggccaaaaagcagaccgaagactacatcaccgggcgctacggctag

DBGET integrated database retrieval system