KEGG   Pseudomonas lundensis: AA042_11965Help
Entry
AA042_11965       CDS       T05473                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
plq  Pseudomonas lundensis
Pathway
plq00550  Peptidoglycan biosynthesis
plq01100  Metabolic pathways
plq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA042_11965
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AA042_11965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:plq01003]
    AA042_11965
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:plq01011]
    AA042_11965
Enzymes [BR:plq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AA042_11965
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AA042_11965
Glycosyltransferases [BR:plq01003]
 Polysaccharide
  Bacterial polysaccharide
   AA042_11965
Peptidoglycan biosynthesis and degradation proteins [BR:plq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AA042_11965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB PrpF
Motif
Other DBs
NCBI-ProteinID: AOZ13288
UniProt: A0A1D9IML3
LinkDB All DBs
Position
complement(2631202..2633628)
Genome map
AA seq 808 aa AA seqDB search
MIRLLKFFGWSFVAVICGLVLGLSGAFLYLSPGLPSVESLRSIQLQIPLRVYTSDGKLIA
EFGEMRRSPIKFADIPPNFINALLSAEDDNFANHYGVDPSSLMRAATQLVKSGHIQSGGS
TITMQVAKNYFLSSERSFSRKTNEILLALQIERELTKDEILELYVNKIYLGNRAYGIESA
AQVYYGKSIRDLSLAQMAMIAGLPKAPSRFNPLANPVRSKERRDWILGRMYKLGKIDQAS
YEAAIAEPVNASYHVPTPEVNAPYIAEMARAEMVGRYGSEAYTEGYRVTTTVPSDLQELA
NKSVEDGLITYDQRHGYRGPESRLPGKTLAVWKQELAKQRPISGLEPAIVTEVDKDGLHV
LTRTGEGRVSWDSMKWARRFLNTNSMGPMPKQPADVAQVGDLIRVQPQADGSFKFSQVPT
VQGALVSLDPNNGAIRALVGGFAFEQSNYNRAMQAKRQPGSSFKPFIYSAALDNGYTAAT
LVNDAPIVFVDDYQDKVWRPKNDNNTFLGPIRVREALYKSRNLVSIRLLQSLGVDKTVDY
ISKFGFSKQDLPRNLSLALGTATLTPMEIAMGWSTFANGGYKITPYLIDKVESRNGETLF
VANPPSVPKEARKDVPPEAEALTIDTLNAALGLPTTETQAVAERIVDGRTTYILTSMLQD
VIKLGTGRRALSLGRTDLAGKTGTTNESKDAWFSGYNADYVTTVWTGFDQPESLGRREYG
GTVALPIWINYMGGALKDKPPHTQAEPEGILSLRVDPISGRVASPGTPGAYFELFKSEDT
PPSNSELGNGVAPGSPLPAEDGAPIDLF
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtctgctgaagtttttcgggtggtcattcgttgctgtgatctgcgggctcgtg
ctcgggttgagtggcgcgtttctctatcttagtcctggcttgccgtccgtagagtcgttg
agaagcatccagttgcagattcctttgcgggtctacaccagcgacggaaagttaatcgca
gagtttggcgaaatgcgccgctctccgatcaagttcgccgacattccccccaacttcatc
aatgcattgctgtcggccgaagatgacaacttcgccaatcattacggggtcgaccccagc
agcctgatgcgtgccgcgacccagttggtaaaaagcggacacatacaatcgggtggcagc
accatcacgatgcaggtggcgaagaactatttcctatccagtgagcggagcttttcccgc
aaaaccaacgaaattctgttggcactgcaaatcgaacgcgagctgaccaaggacgaaatc
cttgagctgtacgtgaacaagatttacctgggcaaccgcgcctacggcatcgaatcggcc
gcccaggtgtattacggcaaatcgatccgcgacttgagcctggcgcaaatggcgatgatc
gctggcctgcccaaagccccctcgcgcttcaacccgctggccaacccggtacgcagtaaa
gaacgtcgcgactggattctgggccgcatgtacaagctgggcaaaatcgatcaggccagc
tacgaagcagcgattgccgaaccggtcaacgccagttatcacgtgccgacaccggaagtg
aacgccccttacattgctgaaatggcccgtgccgaaatggtcggtcgttatggcagcgag
gcctacaccgaaggctatcgcgtcaccaccacggtgccgagtgacctgcaggaactggcc
aacaagtccgtcgaagacgggctgatcacctacgaccagcgccacggctatcgcggccct
gagtcgcgcttgcccggcaagacgctggcggtctggaagcaagagctggccaagcagcgc
ccgattagcggccttgagccagccatcgtgactgaggtcgacaaagatggcttgcatgtc
ctgacccgcacgggtgaaggccgcgtgagctgggacagcatgaagtgggcgcgacgcttc
ctgaacaccaacagcatgggcccgatgcccaaacagccagccgacgtggcgcaggtgggc
gatctgattcgcgtccagccgcaagccgacggcagtttcaagttcagccaggtgccgacc
gtacaaggcgcgctggtttcacttgacccgaacaatggggccatccgcgccttggtgggc
gggttcgcgtttgagcagagcaactacaaccgtgccatgcaggccaagcgccagccaggt
tcaagtttcaagcctttcatttatagcgcagcactggataacggctacaccgccgccacg
ctggtgaacgatgcgccgatcgtgtttgttgacgactaccaggacaaagtctggcggccg
aaaaacgacaacaacaccttcctcggccctatccgcgtgcgtgaagcgctgtacaagtcg
cgcaacctggtgtcgatccgcctgctgcaaagcctgggcgtcgacaagaccgtcgactac
atcagcaaattcggcttcagcaaacaggacttgccgcgcaacctttcgctggcactgggg
accgcgaccttgacgcccatggagatcgccatgggctggagcacctttgccaacggcggt
tataaaatcacgccgtacctgatcgacaaggttgaaagccgtaacggcgagaccctgttc
gtggccaacccgccgagcgtgcctaaagaggcccgcaaagacgtgccgcccgaagccgaa
gcgctgaccatcgacaccctcaatgccgcgctgggcttgccgaccactgaaacccaggcc
gtggccgagcgcatcgtagacgggcgcaccacgtacatcctgaccagcatgctgcaagac
gtgatcaagctcggcactggccgccgcgccttgtcgctggggcgtaccgatctggccggt
aaaaccggtacgaccaacgaatcgaaggatgcctggttctcgggctataacgccgattac
gtgaccacggtgtggaccggcttcgaccagcccgaaagcctcggtcgtcgcgaatacggc
ggcacggtggcgctaccgatctggatcaactacatgggcggcgcactgaaagacaagccg
cctcacacccaggccgagcccgaagggattctcagcctgcgggttgacccgatcagcggc
cgcgtggcgtcgccgggcacaccgggcgcgtacttcgagctgtttaaaagcgaagacacg
ccgccgtccaacagtgagttgggcaatggcgttgcaccgggcagcccgctgcccgcagag
gatggcgccccgatcgacttgttctga

DBGET integrated database retrieval system