KEGG   Pseudomonas lundensis: AA042_20785Help
Entry
AA042_20785       CDS       T05473                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plq  Pseudomonas lundensis
Brite
KEGG Orthology (KO) [BR:plq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA042_20785
Enzymes [BR:plq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AA042_20785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 K_oxygenase Thi4 NAD_binding_8 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AOZ14803
UniProt: A0A1D9IS02
LinkDB All DBs
Position
complement(4610638..4612200)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSREMHDLLKEIASLSSQITLLDNGTDAR
KPSFSLNRPGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASPEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRQVMAVPSVYLNGVNF
GQGRMGLEEILGKLDTGAIERQAEKISAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRADQLIPGKAGEL
HEVKFASGASLKAKTLILATGARWREMNVPGEQEYRSRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDTKLRADAVLQRKLNSLPNVTVITNAQTTEVTGDGQ
KVNGLRYKDRQSGEIHNVELEGIFVQIGLLPNTDWLKGTVELTPRGEIVVDARGETSIPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatttaaaagctcagttgaagtcatacctggagcgggtcacccagccg
atcgagatcgttgcttccctcgacgacggtgcgaaatcccgtgaaatgcatgacttgttg
aaagaaatcgccagcctttccagccagatcaccttgctggacaacggcaccgatgcgcgt
aagccatcgttctcgttgaatcgcccgggcggtgatatcagcctgcgttttgcaggcatc
cccatgggccacgaatttacatcgctggtgctggcattgctgcaagtaggcggccaccca
tcgaaagccagtcccgaagtgatcgaacaaatccgttcattgaaaggtgagttcaacttc
gagacgtacttctcgctgtcctgccagaactgcccggacgtggttcaggcgctgaacctg
atggccgtgctcaaccctaatattcgccacgtggcgattgacggcgcgctgtttcaggac
gaggtcaatgatcgtcaggtcatggcggttcccagcgtctacctcaacggtgtcaacttt
ggtcagggccgcatgggcctggaagagattctcggcaagctggacaccggcgccattgaa
cgtcaggccgagaaaatcagcgccaaagacgcctttgatgtgctggtgatcggtggcggc
ccggccggcgcggcagcggccatttatgccgcccgtaagggcattcgtaccggcgtggca
gcagagcgtttcggcgggcaggtgctcgacaccatggccatcgaaaactttatctcggtg
caagaaaccgaagggccgaaactggccacggcgcttgaagagcacgtcaagcaatacgac
gtggacatcatgaacctgcaacgcgccgatcaattgattcccggcaaagctggcgagctg
cacgaagtgaaattcgccagcggggcgtctttgaaggccaagacactgatactggcgacc
ggtgcgcgctggcgtgaaatgaacgtgcccggcgagcaggaataccgcagccgtggcgtc
gcctactgcccgcactgcgacgggccgctgttcaagggcaagcgcgtggccgtcattggt
ggcggtaactcaggggttgaagccgccatcgacctggccggtatcgttgcccacgtcacg
ttgcttgagttcgacaccaagctgcgtgctgatgccgtcttgcaacgcaagctcaacagc
ttgccgaacgtcacagtgataactaacgcgcaaaccacagaagtgaccggcgacgggcag
aaagtgaatggcctgcgttacaaagatcgtcaatccggcgagatccacaacgtcgagctc
gaaggcatttttgtacagattggtttgctgcccaacacggattggctcaaaggcactgtc
gaattgacaccgcggggcgaaatcgtggtggatgctcgcggcgagacgtcaattccaggt
atttttgcagccggtgacgtgaccaccgtgccgtacaagcagatcgtgatcgcggtagga
gagggcgccaaggcgtcgctgagtgccttcgatcatttgatccgcacgtctgcccctgat
taa

DBGET integrated database retrieval system