KEGG   Planctomyces sp. SH-PL14: VT03_22120Help
Entry
VT03_22120        CDS       T04354                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pls  Planctomyces sp. SH-PL14
Pathway
pls03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pls00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    VT03_22120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pls03400]
    VT03_22120
Enzymes [BR:pls01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VT03_22120
DNA repair and recombination proteins [BR:pls03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VT03_22120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AMV20612
UniProt: A0A142X1L6
LinkDB All DBs
Position
5703043..5705739
Genome map
AA seq 898 aa AA seqDB search
MASAQSQLKEYKRKRDFHKTSEPAGKSSRHRSTKKGLAFVVQKHDASHLHYDFRLEWDGV
LKSWAVPQGPCLDPSLKRLAVQVEDHPLEYGTFEGIIPPGQYGGGTVIVWDNGTWEPLGD
AAEGLRNGKLKFHLHGEKLTGGWTLVRMRRKPGEKKDNWLLIKERDDAARPLKERDIVKD
EPASVLSGVTIGEMAEEPPAEWNSEGPKTGRKSRPTSKTTRSKPAAKPRTAAKSRTSGDK
FPKSIQPELATLVEAPPAGDDWLHEIKLDGYRVVAFVHKDKVQLKTRNDLDWSHRFPEIA
QDLQRRFHGEDLVFDGEVCAVDDEGVTRFGMLQEALSDSQTDGLVYYVFDLLWRDGTDLR
GKSLEVRKDQLAELLGNRPHGRILYSDHQVGQGDKLFRKAADMGLEGIVSKRRDQPYLSG
RGGNWVKSKISQQDEFVIGGFTDSTSATRRLGALLIGYHDNGEFKYAGKVGTGFTEAMTA
DLRERLVTRESDESPFADRVTGAGRGVHWVDPNLVAQIGFTQWTRDGRLRHPVFQGLRED
KPARSVKRDIPKEAPAMEEAPRKTKSSPGGERKPANGTARKAPARRRPTQHHSGPELSAA
DQKQLEQLHLTHPEKVLYPAEGITKLDLVEFYAAVAEWMLPHIENRPLSLVRCPDGVGGP
RFFQKHAAGGTPDALKRIPIREKDETEDYLYIDSLAGLLSTCQMGTLEIHPWGSRCDDIE
KPDRLIFDIDPDEGLAWSKVVGAAREVRDRLQDLGLESFLKVTGGKGLHVVAPIVRRGEW
PEIKAFTRGFVRQMAADDPRAYTTNMSKSERRGKIFLDYLRNDRGATAVAPYSTRARDEA
SVAVPIAWTQLTPQMRSNHFTMKNLTTTLARRRTDPWEEMLTLRQSLTAAMRKSVEET
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggctcaatcacagctcaaggaatacaagcggaaacgggacttccacaaaacc
agcgaaccggcggggaagtcgtcccgacaccgttcgacgaagaagggactcgcctttgtc
gttcagaaacatgacgccagccacctccactacgacttccgtctcgaatgggacggcgtc
ctgaaaagttgggccgtcccgcagggcccgtgcctcgacccctcgctgaaacgcctggcc
gtccaggtggaagaccacccgctggaatacggcaccttcgaagggatcatcccgccgggg
cagtacggcggcggcaccgtcatcgtctgggacaacggcacctgggagccgcttggcgac
gcggcggaaggtctgaggaacggcaagctcaagttccatctccacggcgagaagctgacg
ggcggctggaccctcgtccggatgcgccgcaagccgggggagaagaaggacaactggctc
ctcatcaaggagcgggacgacgcggcccggccgctgaaggagcgggacatcgtgaaggac
gaaccggcgagcgtcctcagcggtgtcacgatcggcgagatggccgaagagccgccggcc
gagtggaactccgaaggcccgaagaccggccgcaagtcccgcccgacttcaaagacaacc
cgatccaagcccgcggccaagcccaggactgcggcgaagtccaggacgtcgggcgacaag
ttcccgaagtcgatccagcccgaactggcgacgctcgtcgaagccccgcccgcgggggac
gactggctgcacgagatcaagctcgacggctaccgcgtcgtcgccttcgttcataaggac
aaggtccagctcaagacgcggaacgacctcgactggtcgcaccgcttcccggagatcgcc
caggacctccagcggcggttccacggcgaggacctggtcttcgatggcgaagtgtgtgcg
gtcgatgacgaaggggtgacgcgtttcgggatgctccaggaggcactcagcgacagccag
accgacgggctcgtctactacgtcttcgacctcttgtggcgggacggaacggacctccgc
gggaagtcgctggaggtccgcaaggaccagctcgcggagctcctcggcaaccgtcctcac
ggccggattctctattcggatcaccaggtggggcagggcgacaaactgtttcggaaggcg
gccgatatggggctggaagggatcgtctccaagcgccgcgaccagccatatctctccggg
cgcggcggcaactgggtcaagtccaagataagccagcaggacgagttcgtcatcggcggt
ttcacggattcgacctccgcgacccgccgtcttggggcgctcctcatcggctatcacgac
aacggcgagttcaagtacgccggcaaagtcgggaccggcttcaccgaggctatgacggcg
gatctccgggaacggctcgtgacccgcgagagcgacgagtccccgttcgcggaccgcgtc
accggagcggggcggggcgtccactgggtcgatccgaacctcgtcgcccagatcggtttc
acgcagtggacccgcgacggccgcctgcggcacccggtcttccagggcctgcgggaagac
aagccggcccgttcggtgaaacgcgacattccgaaggaggccccggcgatggaggaagca
ccgcgcaagacaaagtcgtccccgggtggtgaacgaaagcccgcaaacgggaccgccagg
aaagctccggccaggcgacgccccacccagcaccacagcggccccgaactctccgcggcg
gaccagaagcagctcgaacagctccacctcacgcatcccgagaaggtcctctatcccgcg
gaagggatcaccaagctcgacctcgtagagttctacgccgcggtcgcggagtggatgctg
ccgcacatcgagaaccggccgctgagcctcgtccgctgcccggacggcgtcggcggtccg
cggttcttccagaagcacgccgccggcggcacccccgacgccctcaagcggatcccgatc
cgggagaaggacgaaacggaggactacctctacatcgacagcctcgcggggctcctctcg
acgtgccagatgggaacgctcgagatccacccctggggctcccgctgtgacgacatcgag
aagcccgaccgcctgatcttcgacatcgaccccgacgaaggtctcgcctggtccaaggtc
gtcggagccgcccgcgaggtgcgggatcgcctccaggatctgggcctcgagagctttttg
aaggtgacaggagggaaggggctccacgtcgtcgccccgatcgtccgccgcggcgagtgg
ccggagatcaaagccttcacccgcggcttcgtccgacagatggcggccgacgatccccgc
gcctacacgacgaacatgagcaagagcgaacgccgcggaaagatcttcctcgactacctg
cgaaacgaccgcggcgccaccgccgtcgccccctactccacccgagccagggacgaagcc
tccgtcgcggtcccgatcgcctggacgcagctcaccccgcagatgcgctcgaatcacttc
accatgaagaacctcaccaccaccctcgcgcggcggaggaccgacccctgggaagagatg
ctcacgctccggcagtcgctcaccgccgccatgcgaaagagcgtcgaggaaacctga

DBGET integrated database retrieval system