KEGG   Chlorobium luteolum: Plut_1224Help
Entry
Plut_1224         CDS       T00291                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
plt  Chlorobium luteolum
Brite
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Plut_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N MPM1
Motif
Other DBs
NCBI-ProteinID: ABB24086
UniProt: Q3B3J5
LinkDB All DBs
Position
1379814..1380416
Genome map
AA seq 200 aa AA seqDB search
MAYQQPALPWAENALEPHISAKTLSFHYGKHHAAYVTNYNNLVGGTPLDEMPIEDVIAQT
AGDSSKIGVFNNGAQAWNHSFYWNCLTPNGGGKPSGELAEAIEKDFGGYDAFREELKNAA
ATQFGSGWAWLVLENGTLKVAKTANAETPMTKGMKPILTIDVWEHAYYLDYQNRRPDYTA
AVIDNLINWEFAEENYTAAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccagcaaccagcgctcccttgggcggaaaatgcccttgagccccacatctcc
gctaaaaccctaagcttccattacggcaagcaccatgcggcatatgtcaccaactacaat
aacctcgtcggcggcacgccacttgatgaaatgccgattgaggatgtgattgcccagacg
gccggcgactcgtccaaaatcggggtattcaacaacggagcgcaggcctggaaccacagc
ttctactggaactgcctcaccccgaacggcggtggaaagccttccggtgaacttgctgaa
gcgatagaaaaggatttcggcggctacgatgcattccgtgaagagctgaagaatgccgca
gcgacgcagttcggaagcggatgggcctggctcgtgctggagaacggtaccctgaaggtt
gccaaaacagccaatgcagaaacccccatgacaaaaggcatgaagccgatcctcaccatt
gacgtgtgggaacatgcctactacctcgactatcagaaccgcagaccggattacacggca
gccgtcatcgacaacctcatcaactgggaatttgccgaagaaaactacacggctgcacgc
tga

DBGET integrated database retrieval system