KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu0075Help
Entry
plu0075           CDS       T00149                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     plu0075 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAE12370
Pasteur: plu0075
UniProt: Q7NA70
LinkDB All DBs
Position
73631..74257
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYSYEALEPHFDKQTMEIHHTKHHQTYVNNTNSALEAFPELAGLGIDDLIQQ
LDKIPADKRTFVRNNAGGHANHSLFWKGLKLGTTLQGPLKEAIERDFGSIDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGASGYPITGLDVWEHAYYLQYQ
NRRPDYIKAFWSVVNWDEAAKRYQEKVK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagctattcattaccttctcttccttattcttatgaagctctggaacctcattttgat
aagcagacgatggaaatccaccataccaagcatcatcagacttacgttaataataccaat
agcgccctagaagccttccctgagctggcaggactgggtattgatgatctgattcagcaa
ttagataagatacctgctgataaacgtacttttgttcgtaataatgctggtgggcacgct
aaccatagcttgttttggaaaggtctgaaattaggcacaactctgcaaggcccattaaaa
gaagctattgagcgcgatttcggtagcatagattcttttaaagagaaatttgagcaggca
gcggctacccgttttggttctggctgggcgtggctagtactgaaagatgatggcaaactg
gcagttgtatcgactgctaaccaggatagcccattaatgggtgaagcgatttctggtgca
tctggttatccgattactggtctggatgtttgggaacacgcttattacttacagtaccaa
aaccgtcgtcctgactatattaaagcgttctggagcgttgttaactgggatgaagcagcg
aagcgttatcaggaaaaagtgaaataa

DBGET integrated database retrieval system