KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu0194Help
Entry
plu0194           CDS       T00149                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00564  Glycerophospholipid metabolism
plu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    plu0194 (glpD)
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     plu0194 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 3HCDH_N FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAE12489
Pasteur: plu0194
UniProt: Q7N9W6
LinkDB All DBs
Position
complement(202039..203541)
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLAKATSSSSSKLIHGGLRYLEHYE
FRLVSEALAEREVLLNLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDNLGKRVSLPGS
KGLKFGANSVLKPELVRGFEYSDCWVDDARLVVLNAQEVKKRGGEVRTRTKVTRAWREQE
GWMVEAEDLRTGKTYTWRAKGLVNATGPWVKEFFDDGLKLKSPYGIRLIKGSHIVVPKVH
DEPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYQGDPKEAKIDDQEINYLLRVYNDHF
KKQLNRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDEQGKAPLLSVFGGKLTTYRK
LAEHATEKLMQYYPTAGKAWTRNGQLPGGNLEGCDRDGYARLLRKRYNWLPEGVAVRYAR
TYGSNSELILQGANNLTDLGESFGHGLYETELRYLVDNEWVVELDDAIWRRTKLGMWLKE
EQKQRIAAWLAENAKPRTEI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgtgatcggcggcgggatcaacggtgccggaattgcagca
gatgctgctggccgggggctctctgttctattgctggaagcacaagacttagccaaagcc
acatcatcctccagttcaaaattgatccacggtggcttacgctatctagaacactatgaa
ttccgtttggtcagtgaagcgctggcagaacgtgaagttttactgaatcttgcaccacac
atcgcttttccgatgcgtttccgcctgccgcatcagccacatttacgtccagcatggatg
atccgcattggcctgttcctctatgacaatttgggcaaacgagtcagcctgcctggcagt
aaagggctaaaattcggtgccaattctgttctgaaaccagaattggtccgtggctttgaa
tattctgactgctgggttgatgatgctcgtttagttgtccttaacgctcaagaagtcaaa
aaacgtggcggggaagtccgtacccgaacaaaagtgacccgtgcatggcgcgaacaagag
ggttggatggttgaagccgaagatctgcgtacaggtaagacctatacttggcgtgcaaaa
ggtctggttaatgctaccggcccttgggttaaagaattctttgacgatggtctgaaattg
aaatcaccttatggtattcgcctgatcaaaggcagccatattgtggtgccaaaagtgcat
gatgagccgcaagcttatattctgcaaaatgaagatcatcgtatcgtatttgttattcct
tggatggatgaattttccattatcggaaccaccgatgtggaatatcaaggtgatccaaaa
gaggcgaagattgacgatcaggagattaattatctgctgagagtttataacgaccacttc
aagaaacaacttaaccgtgacgatatcgtctggacctattctggcgtacgtccactgtgt
gatgatgaatccgactcacctcaggccattacgcgcgactatacccttgacatacatgat
gaacagggcaaagcaccattactgtctgtgttcggcggtaaattaactacttaccgtaag
ctggcagaacacgcaaccgaaaagctcatgcaatactatcccacggccggaaaagcctgg
accagaaatggtcagttaccggggggtaatttggaaggatgcgatcgtgatggttatgcc
cgtttattgcgtaaacgttacaactggttaccggaaggcgttgctgtacgttatgcgcgt
acttacggcagcaacagcgaactcattctgcaaggtgctaataatctgaccgatctaggc
gaatccttcggtcacggcctgtatgaaacagagcttcgttatctggtcgataatgaatgg
gtcgttgaactggatgacgcaatctggcgccgtaccaaattgggtatgtggctaaaagaa
gagcagaagcaacgcattgcagcatggttagcggagaatgctaaaccacgcactgagatt
tga

DBGET integrated database retrieval system