KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu0364
Entry
plu0364           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to unknown protein
  KO
K11892  type VI secretion system protein ImpK
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    plu0364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu0364
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu0364
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CAE12659
Pasteur: plu0364
UniProt: Q7N9H2
LinkDB
Position
complement(391509..392279)
AA seq 256 aa
MKTETINGNPIPTQEVTDNAVHLQYQLPLRGESLNPMIDAATPLLGMVMRLKDMGEQPLP
DQLYQQVVTDIQAIEQLLQTKGYEPGAIISFRYTLCTFIDETALGHGWNSKNEWLQQSLL
VRFHNETWGGEKVFQLLDRLMGEPQRYQHLLEFIYLCFCLGYRGRYKVASQKSDDFERLF
RRLHQQLHALRGEAPSIILHNNANERNDRYRLGKRLTIKHLFWSGITLLAIVYSFYAIRL
HNQTQNILQQLNNLLS
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaaaactgaaaccataaatggcaatcctattccgacgcaggaggtcactgataatgcc
gtgcatcttcagtatcagttaccgctgcgcggagaaagcctaaacccgatgatcgatgcc
gctacaccgctgctcggcatggtcatgcgtctaaaagacatgggcgaacaaccgctgccg
gaccagctttatcaacaggtcgtcactgatattcaggcaatcgaacaacttctacaaacc
aaaggctatgagccgggcgcaattatctcttttcgctatacgctctgtaccttcattgat
gaaaccgcattgggtcatggttggaacagcaagaatgagtggttacaacaatcactactg
gttcgattccataatgaaacctggggtggcgaaaaagtttttcagttgctagatcgtttg
atgggtgaacctcagcgctatcaacatctgctggagtttatctatctttgcttctgcctc
ggttaccgtggccgttataaagttgcttcgcagaaaagtgatgactttgaacgtttattc
cgtcgattacaccaacaactgcacgcgctgcggggagaagctccttccatcattctccac
aataacgccaatgagcgtaatgatcgctatcgcctgggtaagcgtctgactattaaacat
ctgttctggagcggtattacgctgctcgctatcgtttatagcttctacgctatccgtctg
cacaaccaaacccagaacatcttacaacagctaaataacttactgagctag

DBGET integrated database retrieval system