KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1764
Entry
plu1764           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to putative oxidoreductase YcbY of Escherichia coli
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
KEGG Orthology (KO) [BR:plu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:plu03009]
    plu1764
Enzymes [BR:plu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     plu1764
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     plu1764
Ribosome biogenesis [BR:plu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    plu1764
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_15 Methyltransf_24 Methyltransf_3 N6_Mtase Phi-29_GP4
Other DBs
NCBI-ProteinID: CAE14057
Pasteur: plu1764
UniProt: Q7N612
LinkDB
Position
2105290..2107407
AA seq 705 aa
MNSLFASTARGLEELLKNELEMLGAQSCKIVQGGVHFQGDGRVMYKSLMWSRLASRILLP
LNEFNVYSDLDLYLGVQSIDWSQVFSVHSTFSVHFSGTNEEIRNTQYGALKVKDAIVDSF
TRKLDQRPNVAKQQPDVRINVFLNKEKASVALDLSGDGLHIRGYRDLAGQAPLKENLAAA
IVQRSGWQIGTPMVDPMCGSGTLLIEAAMMAADRAPGLHRDHWGFTAWLKHDEAIWREVI
TEAQIRFRKGLQETTCRFVGSDIDRRVLDMARSNARRAGVAQLITFQQGDASRLENPLPE
GPAGTVLSNPPYGERLESEPALIALHSLFGRIMKSRFPSWRLSLFSASPELLSCLQLRAE
REFKAKNGPLDCVQKNYLLSDKPHSSEVNVAEDYANRLRKNEKKLAHWAKQQGIDCYRLY
DADLPEYNVAVDRYADKVVIQEYAPPKSVDANKARQRLFDVISATMQVLGLSSNQLVLKT
RQRQKGKSQYERMAEKQEFFLVNEYDAKFWVNLTDYLDTGLFLDHRIARKMLGEMSEGKD
FLNLFAYTGAATVHAGLGGARSTTTVDMSRTYLEWAERNLQANELTGRQHRLIQADCLAW
LARANEQFDLIFIDPPTFSNSKRMEDTFDVQRDHIMLMRQLKRLLRRGGTLMFSNNKRGF
KMDFAELEKVGLVAEEITSKTQSQDFARNRQIHNCWLLRHAGEEK
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgaactctctgtttgccagcacggcgcgtggattagaagaattgttgaagaacgaactg
gaaatgctgggtgcgcaatcatgcaagattgtgcaaggtggagttcattttcaaggtgat
ggcagagtgatgtataaaagtctgatgtggagtaggctggcatcacgtattttgctaccg
ctaaatgaatttaatgtttatagcgatttagatctctatcttggggttcagtctattgat
tggagccaggttttttctgtacatagcactttctctgtgcatttcagtggtacaaatgaa
gagatacgtaacacgcaatatggggcgctaaaagttaaagacgccattgtcgatagtttt
actcgtaagttggatcaacgcccgaatgtggcaaagcagcagccggatgttcgtattaat
gttttcctaaataaagagaaagccagtgttgcattggatttgagtggtgatggtttgcat
atccgaggttatcgcgatcttgctggtcaggctccgctgaaagaaaatctggctgcggcg
attgtccaacgttcaggttggcagatagggactccaatggttgatcccatgtgtggttcc
ggcacattgttaattgaagctgcaatgatggcggctgatcgtgctccgggtttacatcgt
gatcattggggctttactgcttggttaaaacatgatgaagcaatttggcgtgaggtaatc
acagaagcgcagatccgctttcgtaaaggtcttcaggagacaacttgccgttttgttggt
tctgatattgatcgcagagtgctggatatggctcggtcaaatgctcgtcgagctggggtt
gcgcagttgatcacttttcagcaaggtgatgccagtcgtctggaaaatccattaccagaa
ggccctgctgggacagtattaagtaatccaccttatggtgagcgtttggaaagtgagccg
gcattgattgcactgcacagtttgtttgggcggataatgaaaagccgtttccctagctgg
cgtctgtcgctattcagtgcgtcacctgaattgctgagttgtctgcaattacgggctgaa
cgtgagtttaaagctaaaaatggtccactggattgcgtacagaaaaattatctgttgtcg
gataaaccgcattcatcagaggtgaatgtggcggaagattatgccaaccgtctgcgcaaa
aatgaaaagaaattagctcactgggcaaaacagcaagggattgattgttatcgtctgtat
gatgctgatttgccagaatacaatgtggctgttgaccgctatgcggataaagtagtgatt
caggaatatgctccgccgaaaagtgttgatgctaataaagcgcgtcagcgtttattcgat
gttatcagtgcaacgatgcaagttcttggactctcatcaaatcaattagtacttaaaact
cgtcagcgtcagaaaggcaaaagccagtatgaaagaatggcagaaaaacaggaattcttt
ctggtaaatgagtatgacgcaaaattctgggtcaatttaactgactatttggacactggc
ttgttccttgatcaccgtattgcccgaaaaatgctaggtgaaatgagtgaagggaaagat
tttctgaatctgtttgcctataccggagcagcaacggtacatgctggattaggcggtgcg
cgttcaacaacgacggttgatatgtctcgcacttatcttgaatgggctgaacggaactta
caggctaatgaattaactgggcgtcagcatcggctgattcaggcagattgtctcgcttgg
ttggcacgggccaatgaacagtttgatttgatttttattgatccgccaactttttccaat
tctaaacgaatggaagatacatttgatgtacaacgcgaccatatcatgttgatgagacag
cttaagcgcttgttgcgtcgtggcggaacgctgatgttctctaataacaaacgtggtttt
aaaatggattttgctgagctggaaaaagttggcttggtggcagaggaaatcaccagtaaa
acccagtcgcaggattttgcccgcaatcgtcagattcacaactgctggctattacgtcat
gctggtgaggaaaaataa

DBGET integrated database retrieval system