KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1960Help
Entry
plu1960           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to xylitol (sorbitol) dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00040  Pentose and glucuronate interconversions
plu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    plu1960
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     plu1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N Pyr_redox_2 Pyr_redox_3 Methyltransf_25 DAO
Motif
Other DBs
NCBI-ProteinID: CAE14253
Pasteur: plu1960
UniProt: Q7N5I8
LinkDB All DBs
Position
complement(2330184..2331212)
Genome map
AA seq 342 aa AA seqDB search
MKALVLEKAGQISIQDWETPEILGENDVEIKIHSVGICGSDVHYYQYGRIGPFIVEKPMI
LGHEASGVITAVGKNVTHLKIGDRVCMEPGIPNLQSPQSRAGIYNLDPEVRFWATPPIDG
CLRERVIHPAAFTFKLPDNVSFAEGAMVEPLAIGMQAATKAEIKPGDIALVIGAGTIGIV
TALAALAGGCSDVIICDVFDEKLEIAKQYPGLHPVNSKVLTEKVNALTEGNGVNILFECS
GAKPVIATISEHIAPGGIAVLVGMPIDPAPFDVVSAQAKEITFKTIFRYANMYPRTIRLL
SSGKLKVTPLLSATYKFKDSVQAYERAAEGRPTDIKIMLEME
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattagtattagaaaaagcaggtcagatttcaattcaagactgggaaaccccc
gaaatattgggtgaaaatgatgttgaaataaaaattcactcggtggggatttgtggcagc
gatgtgcattattatcaatacgggcgtattgggccatttattgtcgaaaagccgatgatc
ctcgggcacgaagcatcaggtgtcatcaccgcagtaggtaaaaatgtgactcacttaaaa
atcggcgatcgtgtctgtatggaacctggcattcctaatctgcaatcaccacaatcacgg
gcaggtatttataacttagatccagaagtgcgtttctgggcgacgccccctattgatggt
tgcttacgtgaaagagttattcatccggcagcatttacgttcaaattaccggataatgtc
agttttgccgaaggtgcaatggttgaaccattagctatcggtatgcaagccgccacaaaa
gcagaaattaaaccaggagatatcgcattagttattggtgctggcacgatcggaattgtt
accgcacttgccgcattagccggtggttgttctgatgtcattatttgcgatgtgttcgat
gaaaagctagaaattgcaaaacagtatccaggtcttcacccggttaatagcaaagtactt
actgagaaagtgaatgcattaaccgagggtaatggcgtcaatattctctttgaatgtagt
ggcgcaaaaccggtcattgccactatttcagagcacattgcaccgggaggaatagctgtt
ctagtcggtatgcctatcgatccggcaccatttgatgttgtctctgctcaagctaaagag
atcacattcaaaactattttccgctacgcaaatatgtaccctcgtactattcgtttactt
agctcaggtaagctcaaagtaacccctctattatccgcaacctataaatttaaagacagc
gttcaggcgtatgaacgagccgcggagggtcgcccgacagatatcaaaattatgttggaa
atggagtaa

DBGET integrated database retrieval system