KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_00040Help
Entry
A4R40_00040       CDS       T05478                                 

Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00260  Glycine, serine and threonine metabolism
plum00261  Monobactam biosynthesis
plum00270  Cysteine and methionine metabolism
plum00300  Lysine biosynthesis
plum01100  Metabolic pathways
plum01110  Biosynthesis of secondary metabolites
plum01120  Microbial metabolism in diverse environments
plum01130  Biosynthesis of antibiotics
plum01210  2-Oxocarboxylic acid metabolism
plum01230  Biosynthesis of amino acids
Module
plum_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
plum_M00017  Methionine biosynthesis, apartate => homoserine => methionine
plum_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A4R40_00040
   00270 Cysteine and methionine metabolism
    A4R40_00040
   00300 Lysine biosynthesis
    A4R40_00040
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    A4R40_00040
Enzymes [BR:plum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     A4R40_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AWK40032
LinkDB All DBs
Position
complement(8935..10041)
Genome map
AA seq 368 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMIEEQDFDVICPVFFTTSQHGQPAPDFTGQQGTLQNAFDI
EALGALDIIISCQGGDYTNEIYPKLRATGWQGYWIDAASALRMNDDSIIILDPVNHTHIQ
QGLNKGIKTFVGGNCTVSLMLMSLGGLFANDLVEWASVATYQAASGAGARHMRELLVQMG
SLHTQVAKELQDPASAILDIERKVTDFTRSGVMSTEKFSVPLAGSLIPWIDKQLDNGQSR
EEWKGQAETNKILNTGNNIITVDGLCVRIGALRCHSQAFTLKLKKDISIPEIEQLLAAHN
DWVRVIPNDRELSMRELTPAAVTGTLDTPVGRLRKLNMGPEYLSAFTVGDQLLWGAAEPL
RRMLRILI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtgggctttatcggctggcgcggtatggtcggctcagtattaatgcagcgt
atgattgaagagcaggattttgatgttatttgtccggtattcttcacgacatcacaacac
ggacagccagcacctgattttactggtcagcaaggtacgttacagaatgctttcgatatc
gaagctcttggtgctttggatattattattagctgtcaagggggagattatactaatgag
atttatccaaagttaagggcaacgggttggcagggatattggattgatgcagcgtcagcg
ctgcgtatgaatgatgattccatcattattttagatccagttaaccatacgcatattcag
caaggtcttaataaaggcataaaaacttttgttggtggtaattgtaccgttagcctaatg
ttgatgtctttaggaggcttatttgctaatgatttggttgaatgggcttctgttgcaact
tatcaggcagcttctggtgcaggtgctcgtcatatgcgggaactactggttcagatggga
tctctacatactcaggtagcaaaagagttgcaagatccggcatcggctattctggatatt
gaaagaaaagtaacggatttcacccgtagcggagttatgtcaactgagaaatttagcgtg
ccgttggcaggtagtttgattccgtggattgataaacagcttgataatggccaaagccgt
gaagagtggaaaggtcaggcagaaaccaacaagatcctgaataccggtaataacatcatt
actgtggatggtttgtgtgtacgtattggggcgctgcgttgccacagccaggcatttact
ttgaaattgaaaaaagatatttcgattcctgaaattgagcaattactggctgcgcataac
gactgggttcgtgttattccaaatgatcgcgaattgagtatgcgtgaattaactccggcg
gcggtaacgggaactttggatactcctgtagggcgtttacgtaagctgaatatgggacca
gagtatttatctgcttttactgtcggtgaccaactgctgtggggagcagcagagcctctg
cgtcgtatgctacgtatcttgatttaa

DBGET integrated database retrieval system