KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_00605Help
Entry
A4R40_00605       CDS       T05478                                 

Definition
(GenBank) universal stress protein UspB
  KO
K06144  universal stress protein B
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Brite
KEGG Orthology (KO) [BR:plum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plum02000]
    A4R40_00605
Transporters [BR:plum02000]
 Other transporters
  Others
   A4R40_00605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UspB Nbl1_Borealin_N
Motif
Other DBs
NCBI-ProteinID: AWK40131
LinkDB All DBs
Position
complement(126161..126496)
Genome map
AA seq 111 aa AA seqDB search
MFSTIALFWALCLVCIINMMRYFSSLRALLSILRQSDPLLYQSVDGNGFFTTHGQLNKQI
RLVNYINSQRYLDHHDPEVVLRCERLRKQFILTSSLSGLVVICLISMLIWY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtacaatcgcactgttttgggcactgtgtcttgtctgcattatcaatatgatg
cgctacttctcttcactacgagcattgctgtccattcttcgtcaatctgatcccttgctt
tatcaatcagtagacggtaacggctttttcactacacatgggcaacttaataagcaaata
cggctagtaaactatatcaattcacaacgttaccttgatcatcatgatccagaagttgtt
cttcgttgtgaaaggttgagaaaacaatttattttgaccagctcactgagtggattagtt
gttatttgcctgatttctatgttgatttggtattaa

DBGET integrated database retrieval system