KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_06260Help
Entry
A4R40_06260       CDS       T05478                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plum01100  Metabolic pathways
plum01110  Biosynthesis of secondary metabolites
plum01130  Biosynthesis of antibiotics
plum01230  Biosynthesis of amino acids
plum02024  Quorum sensing
Module
plum_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A4R40_06260
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A4R40_06260
Enzymes [BR:plum01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     A4R40_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AWK41149
LinkDB All DBs
Position
1459943..1461037
Genome map
AA seq 364 aa AA seqDB search
MFMQRDALNNVHISGEQILITPKELKQQYPLSDDDLHVIANARKTIADIIQRRDPRLLVV
CGPCSIHDVDAALDYAHRLAALSAELSDSLYIVMRVYFEKPRTTVGWKGLINDPYMDGSF
DVEAGLHIARRLLLSLVKMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMAS
GLSMPVGFKNGTDGSLNTAINAMCAAAMPHRFVGINQSGQVCLLQTQGNPNGHIILRGGK
TPNYSAQHVMECEQQMMQAGLLPSLMIDCSHGNSNKDFRRQSLVVDSVADQIISGNQSIT
GIMLESHINEGNQSSEQPRSEMKYGVSVTDACISWQTTEAVLRKLHQQISMQLSQRMAVL
KKAG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgcaaagagatgcacttaataacgttcacatcagtggtgagcaaattcttatc
accccaaaagaattaaagcaacaatacccactgagtgatgatgatctgcatgttattgca
aatgcacgtaaaacaattgcggatattattcagcgccgtgatccccgtttgctggtagtg
tgtggtccttgctctattcatgacgtggatgcggcgctggattatgctcaccgtttggcc
gctctttctgctgaattgagtgatagcttgtacattgtcatgcgtgtctattttgaaaag
cctcgaacaacagtgggttggaaaggtcttattaatgatccatacatggatggttcattt
gatgtggaagctggcctgcatattgcccgccgcttactacttagtttagtgaaaatggga
ttgcctcttgcaacagaagctttagatccgaatagcccacaatatttgggggatttattc
agttggtctgcaattggtgcgagaactacagaatcccagacacaccgggaaatggcttca
ggtttatctatgccggttggtttcaaaaatgggactgacggtagcttgaacacggcaatt
aatgcgatgtgtgcagccgctatgccacatcgttttgtgggaataaaccagtcggggcag
gtgtgtttattacaaacgcaaggaaacccgaatggacatattatcttgcgtggtggtaag
acccctaattacagtgctcaacatgtaatggaatgtgaacagcaaatgatgcaggctgga
ttattgccatccttgatgattgattgtagtcatggtaactctaataaggattttcgtcgc
caaagtttggttgtagattctgttgcggatcagatcatttcaggtaatcaatctattact
ggcattatgttggagagccatattaatgaaggtaaccaatcttctgagcaaccgcgtagt
gaaatgaaatatggtgtatcagtcactgacgcgtgtattagttggcagacgacagaagca
gttctaagaaaattacatcagcaaattagcatgcaattgtcgcaaagaatggcagtattg
aaaaaagcgggataa

DBGET integrated database retrieval system